Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  RAPID DISCOVERY OF PYRIDO[3,4-D]PYRIMIDINE INHIBITORS OF MONOPOLAR SPINDLE KINASE 1 (MPS1) USING A STRUCTURE-BASED HYDRIDIZATION APPROACH
 
Authors :  P. Innocenti, H. L. Woodward, S. Solanki, N. Naud, I. M. Westwood, N. Cro A. Hayes, J. Roberts, A. T. Henley, R. Baker, A. Faisal, G. Mak, G. Box, M A. De Haven Brandon, L. O'Fee, J. Saville, J. Schmitt, R. Burke, R. L. Montfort, F. I. Raymaud, S. A. Eccles, S. Linardopoulos, J. Blagg, S. H
Date :  27 Oct 15  (Deposition) - 20 Apr 16  (Release) - 11 May 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.18
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Spindle Assembly Checkpoint (Sac), Oncology Target Pyrido[3, 4- D]Pyrimidine Based Inhibitors Selective Against Mps1, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. Innocenti, H. L. Woodward, S. Solanki, S. Naud, I. M. Westwood, N. Cronin, A. Hayes, J. Roberts, A. T. Henley, R. Baker, A. Faisal, G. W. Mak, G. Box, M. Valenti, A. De Haven Brandon, L. O'Fee, H. Saville, J. Schmitt, B. Matijssen, R. Burke, R. L. Van Montfort, F. I. Raynaud, S. A. Eccles, S. Linardopoulos, J. Blagg, S. Hoelder
Rapid Discovery Of Pyrido[3, 4-D]Pyrimidine Inhibitors Of Monopolar Spindle Kinase 1 (Mps1) Using A Structure-Based Hybridization Approach.
J. Med. Chem. V. 59 3671 2016
PubMed-ID: 27055065  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.5B01811

(-) Compounds

Molecule 1 - MONOPOLAR SPINDLE KINASE 1 (MPS1)
    Chains: A
    Engineered: YES
    Organism Scientific: SYNTHETIC CONSTRUCT
    Organism Taxid: 32630
    Other Details: N8-NEOPENTYL-N2-(2-METHOXY-4-(1-METHYL-1H-PYRAZOL-4- YL)PHENYL)PYRIDO[3,4-D]PYRIMIDINE-2,8-DIAMINE
    Synthetic: YES

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric Unit (2, 2)
No.NameCountTypeFull Name
15NW1Ligand/IonN2-(2-METHOXY-4-(1-METHYL-1H-PYRAZOL-4-YL)PHENYL)-N8-NEOPENTYLPYRIDO[3,4-D]PYRIMIDINE-2,8-DIAMINE
2DMS1Ligand/IonDIMETHYL SULFOXIDE
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
15NW2Ligand/IonN2-(2-METHOXY-4-(1-METHYL-1H-PYRAZOL-4-YL)PHENYL)-N8-NEOPENTYLPYRIDO[3,4-D]PYRIMIDINE-2,8-DIAMINE
2DMS2Ligand/IonDIMETHYL SULFOXIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREILE A:531 , GLN A:541 , ALA A:551 , GLU A:603 , CYS A:604 , GLY A:605 , ASN A:606 , ILE A:607 , ASP A:608 , SER A:611 , ALA A:651 , LEU A:654 , ILE A:663 , MET A:671binding site for residue 5NW A 801
2AC2SOFTWARETYR A:525 , TYR A:550binding site for residue DMS A 802

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5EH0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5EH0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5EH0)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5EH0)

(-) Exons   (0, 0)

(no "Exon" information available for 5EH0)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:258
                                                                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeee..eeeeeeeeeee...eeeeeee.....eeeeeeee....hhhhhhhhhhhhhhhhhhh........eeeeee...eeeeee....eehhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee....eee.........ee.......hhhhhhh...hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh...........hhhhhhhhhhhh........hhhhhh.hhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5eh0 A 516 QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDGTVNYMPPEAIKDMKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ 794
                                   525       535       545       555       565       575       585       595       605       615       625       635       645       655       665       685       695  ||   716       726       736       746       756       766       776       786        
                                                                                                                                                                                        674|          698|                                                                                    
                                                                                                                                                                                         685           710
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5EH0)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5EH0)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5EH0)

(-) Gene Ontology  (21, 21)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5NW  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DMS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5eh0)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5eh0
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TTK_HUMAN | P33981
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  TTK_HUMAN | P33981
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TTK_HUMAN | P33981: 2x9e 2zmc 2zmd 3cek 3dbq 3gfw 3h9f 3hmn 3hmo 3hmp 3vqu 3w1f 3wyx 3wyy 3wzj 3wzk 4b94 4bhz 4bi0 4bi1 4bi2 4c4e 4c4f 4c4g 4c4h 4c4i 4c4j 4cv8 4cv9 4cva 4d2s 4h7x 4h7y 4js8 4jt3 4o6l 4zeg 5ap0 5ap1 5ap2 5ap3 5ap4 5ap5 5ap6 5ap7 5ehl 5eho 5ehy 5ei2 5ei6 5ei8 5ljj 5n7v 5n84 5n87 5n93 5n9s 5na0 5nad

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5EH0)