Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  THE STRUCTURE OF DOUBLE RINGED TRIMERIC SHELL PROTEIN MSM0271 FROM THE RMM MICROCOMPARTMENT
 
Authors :  E. Mallette, M. S. Kimber
Date :  03 Aug 16  (Deposition) - 14 Dec 16  (Release) - 08 Feb 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A,B,C  (2x)
Keywords :  Bacterial Microcompartment, Shell, Bmc-Fp, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  E. Mallette, M. S. Kimber
A Complete Structural Inventory Of The Mycobacterial Microcompartment Shell Proteins Constrains Models Of Global Architecture And Transport.
J. Biol. Chem. V. 292 1197 2017
PubMed-ID: 27927988  |  Reference-DOI: 10.1074/JBC.M116.754093

(-) Compounds

Molecule 1 - MSM0271 PROTEIN
    Chains: A, B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET28A
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Gene: MSMEG_0271, MSMEI_0264
    Organism Scientific: MYCOBACTERIUM SMEGMATIS (STRAIN ATCC 700084 / MC(2)155)
    Organism Taxid: 246196
    Strain: ATCC 700084 / MC(2)155

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit : ABC
Biological Unit 1 (2x): ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5SUH)

(-) Sites  (0, 0)

(no "Site" information available for 5SUH)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5SUH)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric Unit
No.Residues
1Ser A:53 -Pro A:54
2Thr A:157 -Pro A:158
3Ser B:53 -Pro B:54
4Thr B:157 -Pro B:158
5Ser C:53 -Pro C:54
6Thr C:157 -Pro C:158

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5SUH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5SUH)

(-) Exons   (0, 0)

(no "Exon" information available for 5SUH)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:204
                                                                                                                                                                                                                                            
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeeee...hhhhhhhh..........eeeeeeeehhhhhhhhhhhhhhhh...eeeeeee....eeeeeee.hhhhhhhhhhhhhhhhh.hhhhh...eeeeeeee...hhhhhhhhh............eeeeeeeehhhhhhhhhhhhhhhh...eeeeee.....eeeeeeehhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5suh A  10 RTQIRVYLLVEDLQRQFAAYLARGYPPYEGEHALIVEVSPALAIERVIDLALRAVPGVQPGILYVERQFGVLEIHSASLDEVRRAGEAILAGTGNRAEDQLRPRVLFHDIITDITDQHAVILNRNRQASMILPGQSLLVYEMTPALFAAVAANEAERVAPGLTVVDVQMIGAAGRLYIGGSTDEVTVARDHITTVLSAIEGQEH 218
                                    19        29||      44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214    
                                               30|                                                                                                                                                                                      
                                                36                                                                                                                                                                                      


Chain B from PDB  Type:PROTEIN  Length:202
                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee...................eeeeeeeehhhhhhhhhhhhhhhh...eeeeeee....eeeeeee.hhhhhhhhhhhhhhhhh.hhhhh...eeeeeeee...hhhhhhhhhhh..........eeeeeeeehhhhhhhhhhhhhhhh...eeeeee.....eeeeeeehhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5suh B  10 RTQIRVYLLVEDLQRQFAAARGYPPYEGEHALIVEVSPALAIERVIDLALRAVPGVQPGILYVERQFGVLEIHSASLDEVRRAGEAILAGTGNRAEDQLRPRVLFHDIITDITDQHAVILNRNRQASMILPGQSLLVYEMTPALFAAVAANEAERVAPGLTVVDVQMIGAAGRLYIGGSTDEVTVARDHITTVLSAIEGQEH 218
                                    19        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216  
                                             28|                                                                                                                                                                                      
                                              36                                                                                                                                                                                      


Chain C from PDB  Type:PROTEIN  Length:203
                                                                                                                                                                                                                                           
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee...hhhhhhhh.........eeeeeeeehhhhhhhhhhhhhhhh...eeeeeee....eeeeeee.hhhhhhhhhhhhhhhhh.hhhhh...eeeeeeee...hhhhhhhhhh...........eeeeeeeehhhhhhhhhhhhhhhh...eeeeee.....eeeeeeehhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5suh C  10 RTQIRVYLLVEDLQRQFAAYLRGYPPYEGEHALIVEVSPALAIERVIDLALRAVPGVQPGILYVERQFGVLEIHSASLDEVRRAGEAILAGTGNRAEDQLRPRVLFHDIITDITDQHAVILNRNRQASMILPGQSLLVYEMTPALFAAVAANEAERVAPGLTVVDVQMIGAAGRLYIGGSTDEVTVARDHITTVLSAIEGQEH 218
                                    19        29||      45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215   
                                               30|                                                                                                                                                                                     
                                                37
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5SUH)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5SUH)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5SUH)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5SUH)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5suh)
 
  Sites
(no "Sites" information available for 5suh)
 
  Cis Peptide Bonds
    Ser A:53 - Pro A:54   [ RasMol ]  
    Ser B:53 - Pro B:54   [ RasMol ]  
    Ser C:53 - Pro C:54   [ RasMol ]  
    Thr A:157 - Pro A:158   [ RasMol ]  
    Thr B:157 - Pro B:158   [ RasMol ]  
    Thr C:157 - Pro C:158   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5suh
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0QP48_MYCS2 | A0QP48
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A0QP48_MYCS2 | A0QP48
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5SUH)

(-) Related Entries Specified in the PDB File

5l37 5l38 5l39