Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  FLAVIN-DEPENDENT THYMIDYLATE SYNTHASE IN COMPLEX WITH FAD AND 2'-DEOXYURIDINE-5'-MONOSULFATE
 
Authors :  S. M. Bernard, F. W. Stull, J. L. Smith
Date :  08 Mar 16  (Deposition) - 08 Jun 16  (Release) - 22 Jun 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.95
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (4x)
Keywords :  Fad-Dependent, Nucleotide Biosynthesis, Reductive Methylation, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  F. W. Stull, S. M. Bernard, A. Sapra, J. L. Smith, E. R. Zuiderweg, B. A. Palfey
Deprotonations In The Reaction Of Flavin-Dependent Thymidylate Synthase.
Biochemistry V. 55 3261 2016
PubMed-ID: 27214228  |  Reference-DOI: 10.1021/ACS.BIOCHEM.6B00510

(-) Compounds

Molecule 1 - THYMIDYLATE SYNTHASE THYX
    ChainsA
    EC Number2.1.1.148
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneTHYX, THY1, TM_0449
    Organism ScientificTHERMOTOGA MARITIMA (STRAIN ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
    Organism Taxid243274
    StrainATCC 43589 / MSB8 / DSM 3109 / JCM 10099
    SynonymTSASE

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (4x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 3)

Asymmetric Unit (3, 3)
No.NameCountTypeFull Name
1DUS1Ligand/Ion2'-DEOXY-5'-O-SULFOURIDINE
2FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
3RBF1Ligand/IonRIBOFLAVIN
Biological Unit 1 (3, 12)
No.NameCountTypeFull Name
1DUS4Ligand/Ion2'-DEOXY-5'-O-SULFOURIDINE
2FAD4Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
3RBF4Ligand/IonRIBOFLAVIN

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETHR A:55 , GLU A:58 , ARG A:78 , HIS A:79 , ARG A:80 , ILE A:81 , ASN A:85 , GLU A:86 , SER A:88 , TYR A:91 , ASN A:163 , ARG A:165 , ASN A:169 , LEU A:173 , ARG A:174 , HIS A:178 , DUS A:302 , RBF A:303 , HOH A:406 , HOH A:409 , HOH A:414 , HOH A:423 , HOH A:464 , HOH A:467 , HOH A:474 , HOH A:475 , HOH A:479binding site for residue FAD A 301
2AC2SOFTWAREARG A:74 , GLN A:75 , ARG A:78 , GLU A:86 , LEU A:87 , SER A:88 , GLY A:89 , ARG A:90 , ARG A:147 , ARG A:174 , FAD A:301 , HOH A:417 , HOH A:455 , HOH A:456binding site for residue DUS A 302
3AC3SOFTWAREARG A:40 , TYR A:47 , HIS A:53 , THR A:55 , ASN A:85 , TYR A:91 , FAD A:301binding site for residue RBF A 303

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5IOR)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5IOR)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5IOR)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5IOR)

(-) Exons   (0, 0)

(no "Exon" information available for 5IOR)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eee...eeeeeeeee.hhhhhhhhhhh......hhhhhhhhhhhhhhh..hhhhhh.eeeeeeeeehhhhhhhh.....eeee...............hhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh....eeeeeeeeehhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5ior A   2 KIDILDKGFVELVDVMGNDLSAVRAARVSFDMGKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKEV 218
                                    11        21        31  ||    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212      
                                                           34|                                                                                                                                                                                      
                                                            36                                                                                                                                                                                      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5IOR)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5IOR)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5IOR)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    DUS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    RBF  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5ior)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ior
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  THYX_THEMA | Q9WYT0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.148
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  THYX_THEMA | Q9WYT0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        THYX_THEMA | Q9WYT01kq4 1o24 1o25 1o26 1o27 1o28 1o29 1o2a 1o2b 3g4a 3g4c 3n0b 3n0c 4gt9 4gta 4gtb 4gtc 4gtd 4gte 4gtf 4gtl 4kar 4kas 4kat 5chp 5ioq 5ios 5iot 5jfe

(-) Related Entries Specified in the PDB File

5ioq 5ios 5iot