Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  T. MARITIMA FDTS (E144R MUTANT) WITH FAD AND DUMP
 
Authors :  I. I. Mathews, S. A. Lesley, A. Kohen, A. Prabhakar
Date :  28 Aug 12  (Deposition) - 17 Oct 12  (Release) - 17 Oct 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.76
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Flavin-Dependent Thymidylate Synthase, Tm0449, E144R Mutant, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  E. M. Koehn, L. L. Perissinotti, S. Moghram, A. Prabhakar, S. A. Lesley I. I. Mathews, A. Kohen
Folate Binding Site Of Flavin-Dependent Thymidylate Synthase.
Proc. Natl. Acad. Sci. Usa V. 109 15722 2012
PubMed-ID: 23019356  |  Reference-DOI: 10.1073/PNAS.1206077109

(-) Compounds

Molecule 1 - THYMIDYLATE SYNTHASE THYX
    Chains: A, B, C, D
    EC Number: 2.1.1.148
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: THYX, THY1, TM_0449
    Mutation: YES
    Organism Scientific: THERMOTOGA MARITIMA
    Organism Taxid: 243274
    Strain: ATCC 43589 / MSB8 / DSM 3109 / JCM 10099
    Synonym: TS, TSASE

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric/Biological Unit (2, 8)
No.NameCountTypeFull Name
1FAD4Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
2UMP4Ligand/Ion2'-DEOXYURIDINE 5'-MONOPHOSPHATE

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:86 , SER A:88 , ARG A:144 , ARG A:147 , HOH A:416 , HOH A:437 , HOH A:499 , GLN D:75 , ARG D:78 , ARG D:174 , FAD D:301BINDING SITE FOR RESIDUE UMP A 301
2AC2SOFTWAREARG A:78 , HIS A:79 , ARG A:80 , ILE A:81 , ASN A:169 , LEU A:173 , ARG A:174 , HIS A:178 , HOH A:413 , HOH A:415 , HOH A:469 , HOH A:484 , HOH A:485 , HOH A:497 , HOH A:500 , THR C:55 , GLU C:58 , ILE C:81 , ASN C:163 , ARG C:165 , ASN C:169 , FAD C:301 , HOH C:402 , SER D:83 , ASN D:85 , GLU D:86 , UMP D:302BINDING SITE FOR RESIDUE FAD A 302
3AC3SOFTWAREGLU B:86 , SER B:88 , ARG B:144 , ARG B:147 , HOH B:408 , HOH B:411 , HOH B:455 , HOH B:464 , GLN C:75 , ARG C:78 , ARG C:174 , FAD C:301BINDING SITE FOR RESIDUE UMP B 301
4AC4SOFTWAREARG B:78 , HIS B:79 , ARG B:80 , ILE B:81 , ASN B:169 , LEU B:173 , ARG B:174 , HIS B:178 , HOH B:418 , HOH B:427 , HOH B:434 , HOH B:474 , ASN C:85 , GLU C:86 , SER C:88 , UMP C:302 , THR D:55 , GLU D:58 , ILE D:81 , ASN D:163 , ARG D:165 , FAD D:301 , HOH D:430BINDING SITE FOR RESIDUE FAD B 302
5AC5SOFTWARETHR A:55 , GLU A:58 , ILE A:81 , ASN A:163 , ARG A:165 , FAD A:302 , SER B:83 , ASN B:85 , GLU B:86 , SER B:88 , UMP B:301 , ARG C:78 , HIS C:79 , ARG C:80 , ILE C:81 , ASN C:169 , LEU C:173 , ARG C:174 , HIS C:178 , HOH C:404 , HOH C:406 , HOH C:420 , HOH C:447BINDING SITE FOR RESIDUE FAD C 301
6AC6SOFTWAREGLN B:75 , ARG B:78 , ARG B:174 , FAD B:302 , GLU C:86 , SER C:88 , ARG C:144 , ARG C:147 , HOH C:411 , HOH C:417 , HOH C:449BINDING SITE FOR RESIDUE UMP C 302
7AC7SOFTWAREASN A:85 , GLU A:86 , SER A:88 , UMP A:301 , THR B:55 , GLU B:58 , ILE B:81 , ASN B:163 , ARG B:165 , FAD B:302 , HOH B:475 , ARG D:78 , HIS D:79 , ARG D:80 , ILE D:81 , ASN D:169 , LEU D:173 , HIS D:178 , HOH D:407 , HOH D:410 , HOH D:424 , HOH D:458 , HOH D:459BINDING SITE FOR RESIDUE FAD D 301
8AC8SOFTWAREGLN A:75 , ARG A:78 , ARG A:174 , FAD A:302 , HOH A:407 , GLU D:86 , ARG D:147 , HOH D:423 , HOH D:433BINDING SITE FOR RESIDUE UMP D 302

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4GTD)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4GTD)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4GTD)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4GTD)

(-) Exons   (0, 0)

(no "Exon" information available for 4GTD)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains d4gtda_ A: Thy1 homologue                                                                                                                                                                                          SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeee...eeeeeeeee.hhhhhhhhhhh.....hhhhhhhhhhhhhh.hhhhhh.eeeeeeeeehhhhhhhh.....eeee..........hhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh....eeeeeeeeehhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4gtd A  -1 HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPRRVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE 217
                                     8        18        28    ||  42        52        62        72        82     || 97       107       117       127       137       147       157       167       177       187       197       207       217
                                                             33|                                                88|                                                                                                                           
                                                              38                                                 94                                                                                                                           

Chain B from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                      
               SCOP domains d4gtdb_ B: Thy1 homologue                                                                                                                                                                                              SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee...eeeeeeeee.hhhhhhhhhhh...hhhhhhhhhhhhhh..hhhhhh.eeeeeeeeehhhhhhhh.....eeee.............hhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh....eeeeeeeeehhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gtd B   0 HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPRRVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKEVQV 220
                                     9        19        29 ||     44        54        64        74        84      ||96       106       116       126       136       146       156       166       176       186       196       206       216    
                                                          31|                                                    91|                                                                                                                              
                                                           37                                                     94                                                                                                                              

Chain C from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains d4gtdc_ C: Thy1 homologue                                                                                                                                                                                                SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeee...eeeeeeeee.hhhhhhhhhhh.......hhhhhhhhhhhhhhh..hhhhhh.eeeeeeeeehhhhhhhh.....eeee...........hhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh....eeeeeeeeehhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4gtd C   1 MKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPRRVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKEVQV 220
                                    10        20        30        40        50        60        70        80       |94       104       114       124       134       144       154       164       174       184       194       204       214      
                                                                                                                  88|                                                                                                                               
                                                                                                                   93                                                                                                                               

Chain D from PDB  Type:PROTEIN  Length:211
                                                                                                                                                                                                                                                   
               SCOP domains d4gtdd_ D: Thy1 homologue                                                                                                                                                                                           SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee...eeeeeeeee.hhhhhhhhhhh....hhhhhhhhhhhhhhhh.hhhhhh.eeeeeeeeehhhhhhhh.....eeee.............hhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh....eeeeeeeeehhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gtd D   0 HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPRRVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL 215
                                     9        19        29  ||    42        52        62        72        82    ||  94       104       114       124       134       144       154       164       174       184       194       204       214 
                                                           32|                                                 87|                                                                                                                             
                                                            36                                                  90                                                                                                                             

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4GTD)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4GTD)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UMP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4gtd)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4gtd
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  THYX_THEMA | Q9WYT0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.148
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  THYX_THEMA | Q9WYT0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        THYX_THEMA | Q9WYT0: 1kq4 1o24 1o25 1o26 1o27 1o28 1o29 1o2a 1o2b 3g4a 3g4c 3n0b 3n0c 4gt9 4gta 4gtb 4gtc 4gte 4gtf 4gtl 4kar 4kas 4kat 5chp 5ioq 5ior 5ios 5iot 5jfe

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4GTD)