Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF N299A/S303A ASPERGILLUS TERREUS ARISTOLOCHENE SYNTHASE COMPLEXED WITH (1S,8S,9AR)-1,9A-DIMETHYL-8-(PROP-1-EN-2-YL) DECAHYDROQUINOLIZIN-5-IUM
 
Authors :  M. Chen, D. W. Christianson
Date :  06 Mar 16  (Deposition) - 25 May 16  (Release) - 01 Jun 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.53
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A (1x),B (1x)
Biol. Unit 2:  C (1x),D (1x)
Biol. Unit 3:  A (1x),B (1x),C (1x),D (1x)
Keywords :  Lyase, Terpene Cyclases, Lyase-Lyase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Chen, W. K. Chou, N. Al-Lami, J. A. Faraldos, R. K. Allemann, D. E. Cane, D. W. Christianson
Probing The Role Of Active Site Water In The Sesquiterpene Cyclization Reaction Catalyzed By Aristolochene Synthase.
Biochemistry V. 55 2864 2016
PubMed-ID: 27172425  |  Reference-DOI: 10.1021/ACS.BIOCHEM.6B00343

(-) Compounds

Molecule 1 - ARISTOLOCHENE SYNTHASE
    ChainsA, B, C, D
    EC Number4.2.3.9
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneARI1
    MutationYES
    Organism ScientificASPERGILLUS TERREUS
    Organism Taxid33178
    SynonymAS,SESQUITERPENE CYCLASE

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A (1x)B (1x)  
Biological Unit 2 (1x)  C (1x)D (1x)
Biological Unit 3 (1x)A (1x)B (1x)C (1x)D (1x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 21)

Asymmetric Unit (4, 21)
No.NameCountTypeFull Name
1GOL1Ligand/IonGLYCEROL
2JF14Ligand/Ion(1S,5S,8S,9AR)-1,9A-DIMETHYL-8-(PROP-1-EN-2-YL)OCTAHYDRO-2H-QUINOLIZINIUM
3MG12Ligand/IonMAGNESIUM ION
4POP4Ligand/IonPYROPHOSPHATE 2-
Biological Unit 1 (3, 3)
No.NameCountTypeFull Name
1GOL1Ligand/IonGLYCEROL
2JF11Ligand/Ion(1S,5S,8S,9AR)-1,9A-DIMETHYL-8-(PROP-1-EN-2-YL)OCTAHYDRO-2H-QUINOLIZINIUM
3MG-1Ligand/IonMAGNESIUM ION
4POP1Ligand/IonPYROPHOSPHATE 2-
Biological Unit 2 (2, 2)
No.NameCountTypeFull Name
1GOL-1Ligand/IonGLYCEROL
2JF11Ligand/Ion(1S,5S,8S,9AR)-1,9A-DIMETHYL-8-(PROP-1-EN-2-YL)OCTAHYDRO-2H-QUINOLIZINIUM
3MG-1Ligand/IonMAGNESIUM ION
4POP1Ligand/IonPYROPHOSPHATE 2-
Biological Unit 3 (2, 4)
No.NameCountTypeFull Name
1GOL-1Ligand/IonGLYCEROL
2JF12Ligand/Ion(1S,5S,8S,9AR)-1,9A-DIMETHYL-8-(PROP-1-EN-2-YL)OCTAHYDRO-2H-QUINOLIZINIUM
3MG-1Ligand/IonMAGNESIUM ION
4POP2Ligand/IonPYROPHOSPHATE 2-

(-) Sites  (21, 21)

Asymmetric Unit (21, 21)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:84 , ARG A:169 , ASN A:213 , SER A:217 , LYS A:220 , GLU A:221 , ARG A:308 , TYR A:309 , MG A:402 , MG A:403 , MG A:404 , JF1 A:406 , HOH A:502 , HOH A:505 , HOH A:509 , HOH A:519 , HOH A:531 , HOH A:533 , HOH A:581binding site for residue POP A 401
02AC2SOFTWAREASP A:84 , POP A:401 , MG A:403 , HOH A:509 , HOH A:519 , HOH A:533 , HOH A:546binding site for residue MG A 402
03AC3SOFTWAREASP A:84 , GLU A:88 , POP A:401 , MG A:402 , HOH A:502 , HOH A:519 , HOH A:531binding site for residue MG A 403
04AC4SOFTWAREASN A:213 , SER A:217 , GLU A:221 , POP A:401 , HOH A:505binding site for residue MG A 404
05AC5SOFTWAREARG A:107 , GLU A:142 , ARG A:149 , ARG C:197 , GLU C:200binding site for residue GOL A 405
06AC6SOFTWARETYR A:61 , PHE A:81 , VAL A:173 , LEU A:178 , LEU A:209 , ASN A:213 , POP A:401binding site for residue JF1 A 406
07AC7SOFTWAREPHE B:81 , ASP B:84 , ARG B:169 , ASN B:213 , SER B:217 , LYS B:220 , GLU B:221 , ARG B:308 , TYR B:309 , MG B:402 , MG B:403 , MG B:404 , JF1 B:405 , HOH B:510 , HOH B:511 , HOH B:515 , HOH B:536 , HOH B:540binding site for residue POP B 401
08AC8SOFTWAREASP B:84 , POP B:401 , MG B:403 , HOH B:529 , HOH B:539 , HOH B:540 , HOH B:554binding site for residue MG B 402
09AC9SOFTWAREASP B:84 , GLU B:88 , LYS B:220 , POP B:401 , MG B:402 , HOH B:510 , HOH B:511 , HOH B:529binding site for residue MG B 403
10AD1SOFTWAREASN B:213 , SER B:217 , GLU B:221 , POP B:401 , HOH B:536binding site for residue MG B 404
11AD2SOFTWARETYR B:61 , PHE B:81 , PHE B:147 , VAL B:173 , LEU B:178 , LEU B:209 , ASN B:213 , POP B:401binding site for residue JF1 B 405
12AD3SOFTWAREPHE C:81 , ASP C:84 , ARG C:169 , ASN C:213 , SER C:217 , LYS C:220 , GLU C:221 , ARG C:308 , TYR C:309 , MG C:402 , MG C:403 , MG C:404 , JF1 C:405 , HOH C:514 , HOH C:516binding site for residue POP C 401
13AD4SOFTWAREASP C:84 , POP C:401 , MG C:403 , HOH C:510 , HOH C:514 , HOH C:520 , HOH C:533binding site for residue MG C 402
14AD5SOFTWAREASP C:84 , GLU C:88 , LYS C:220 , POP C:401 , MG C:402 , HOH C:510 , HOH C:516binding site for residue MG C 403
15AD6SOFTWAREASN C:213 , SER C:217 , GLU C:221 , POP C:401 , HOH C:504binding site for residue MG C 404
16AD7SOFTWARETYR C:61 , PHE C:81 , VAL C:173 , LEU C:178 , ASN C:213 , POP C:401binding site for residue JF1 C 405
17AD8SOFTWAREPHE D:81 , ASP D:84 , ARG D:169 , ASN D:213 , SER D:217 , LYS D:220 , GLU D:221 , ARG D:308 , TYR D:309 , MG D:402 , MG D:403 , MG D:404 , JF1 D:405 , HOH D:501 , HOH D:508 , HOH D:512 , HOH D:520binding site for residue POP D 401
18AD9SOFTWAREASP D:84 , POP D:401 , MG D:403 , HOH D:501 , HOH D:511 , HOH D:515 , HOH D:523binding site for residue MG D 402
19AE1SOFTWAREASP D:84 , GLU D:88 , LYS D:220 , POP D:401 , MG D:402 , HOH D:508 , HOH D:512 , HOH D:523binding site for residue MG D 403
20AE2SOFTWAREASN D:213 , SER D:217 , GLU D:221 , POP D:401 , HOH D:503binding site for residue MG D 404
21AE3SOFTWARETYR D:61 , PHE D:81 , VAL D:173 , LEU D:178 , ASN D:213 , POP D:401binding site for residue JF1 D 405

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5IMN)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5IMN)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5IMN)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5IMN)

(-) Exons   (0, 0)

(no "Exon" information available for 5IMN)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:304
                                                                                                                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5imn A   8 LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGAELWAQTTLRYSV 311
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307    

Chain B from PDB  Type:PROTEIN  Length:304
                                                                                                                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5imn B   8 LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGAELWAQTTLRYSV 311
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307    

Chain C from PDB  Type:PROTEIN  Length:304
                                                                                                                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5imn C   8 LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGAELWAQTTLRYSV 311
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307    

Chain D from PDB  Type:PROTEIN  Length:304
                                                                                                                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5imn D   8 LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGAELWAQTTLRYSV 311
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5IMN)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5IMN)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5IMN)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    JF1  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    POP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5imn)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5imn
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ARIS_ASPTE | Q9UR08
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.2.3.9
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ARIS_ASPTE | Q9UR08
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ARIS_ASPTE | Q9UR082e4o 2oa6 3bnx 3bny 3cke 4kux 4kvd 4kvi 4kvw 4kvy 4kwd 5imi 5imp 5in8 5ivg

(-) Related Entries Specified in the PDB File

5imi 5imp 5in8