Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF Y200L MUTANT OF RAT CATECHOL-O-METHYLTRANSFERASE IN COMPLEX WITH ADOMET AND 3,5-DINITROCATECHOL
 
Authors :  C. Levy
Date :  22 Dec 15  (Deposition) - 03 Feb 16  (Release) - 24 Feb 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.63
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Methyltransferase Regioselectivity, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. J. Law, M. R. Bennett, M. L. Thompson, C. Levy, S. A. Shepherd, D. Leys J. Micklefield
Effects Of Active-Site Modification And Quaternary Structur On The Regioselectivity Of Catechol-O-Methyltransferase.
Angew. Chem. Int. Ed. Engl. V. 55 2683 2016
PubMed-ID: 26797714  |  Reference-DOI: 10.1002/ANIE.201508287

(-) Compounds

Molecule 1 - CATECHOL O-METHYLTRANSFERASE
    Chains: A, B
    EC Number: 2.1.1.6
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET21B
    Expression System Taxid: 469008
    Gene: COMT
    Organism Common: NORWAY RAT
    Organism Scientific: RATTUS NORVEGICUS
    Organism Taxid: 10116

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 7)

Asymmetric/Biological Unit (4, 7)
No.NameCountTypeFull Name
1BR1Ligand/IonBROMIDE ION
2DNC2Ligand/Ion3,5-DINITROCATECHOL
3MG2Ligand/IonMAGNESIUM ION
4SAM2Ligand/IonS-ADENOSYLMETHIONINE

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETRP A:81 , ASP A:184 , TRP A:186 , LYS A:187 , ASP A:212 , ASN A:213 , MG A:302 , SAM A:303 , HOH A:419 , HOH A:434 , HOH A:442binding site for residue DNC A 301
2AC2SOFTWAREASP A:184 , ASP A:212 , ASN A:213 , DNC A:301 , HOH A:434binding site for residue MG A 302
3AC3SOFTWAREMET A:83 , VAL A:85 , GLY A:109 , ALA A:110 , TYR A:111 , TYR A:114 , SER A:115 , GLU A:133 , MET A:134 , TYR A:138 , GLY A:160 , ALA A:161 , SER A:162 , GLN A:163 , ASP A:184 , HIS A:185 , TRP A:186 , DNC A:301 , HOH A:450 , HOH A:498 , HOH A:564binding site for residue SAM A 303
4AC4SOFTWARETRP B:81 , ASP B:184 , LYS B:187 , ASP B:212 , ASN B:213 , MG B:302 , SAM B:303 , HOH B:443 , HOH B:446binding site for residue DNC B 301
5AC5SOFTWAREASP B:184 , ASP B:212 , ASN B:213 , DNC B:301 , HOH B:443binding site for residue MG B 302
6AC6SOFTWAREMET B:83 , VAL B:85 , GLY B:109 , ALA B:110 , TYR B:111 , TYR B:114 , SER B:115 , GLU B:133 , MET B:134 , TYR B:138 , GLY B:160 , ALA B:161 , SER B:162 , GLN B:163 , ASP B:184 , HIS B:185 , TRP B:186 , DNC B:301 , HOH B:472 , HOH B:541 , HOH B:553binding site for residue SAM B 303

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5FHR)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Val A:216 -Pro A:217
2Val B:216 -Pro B:217

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5FHR)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5FHR)

(-) Exons   (0, 0)

(no "Exon" information available for 5FHR)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:213
                                                                                                                                                                                                                                                     
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhh......eeeeee.hhhhhhhhhhhhhhhh....eeeee.hhhhhh.hhhhhhh.....eeee..hhhhhhhhhhhhhhh.......eeee.......hhhhhhhhhhh..eeeeeeeee......eeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5fhr A  46 DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLELMKVVDGLEKAIYQGP 258
                                    55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255   


Chain B from PDB  Type:PROTEIN  Length:213
                                                                                                                                                                                                                                                     
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh..eeeee....hhhhhhhhh......eeeee..hhhhhhhhhhhhhhhhhhh.eeee..hhhhhh.hhhhhhh...eeeeee..hhhhhhhhhhhhhhh..eeeeeeeee.......hhhhhhhhhhh..eeeeeeeee......eeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5fhr B  46 DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLELMKVVDGLEKAIYQGP 258
                                    55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5FHR)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5FHR)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5FHR)

(-) Gene Ontology  (42, 42)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DNC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SAM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Val A:216 - Pro A:217   [ RasMol ]  
    Val B:216 - Pro B:217   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5fhr
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  COMT_RAT | P22734
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.6
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  COMT_RAT | P22734
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        COMT_RAT | P22734: 1h1d 1jr4 1vid 2cl5 2zlb 2zth 2zvj 3a7d 3hvh 3hvi 3hvj 3hvk 3nw9 3nwb 3nwe 3oe4 3oe5 3ozr 3ozs 3ozt 3r6t 3s68 3u81 4p7g 4p7j 4p7k 4pyl 4pym 4pyn 4pyo 4pyq 5fhq 5k01 5k03 5k05 5k09 5k0b 5k0c 5k0e 5k0f 5k0g 5k0j 5k0l 5k0n 5lqa 5lqc 5lqj 5lqk 5lqn 5lqr 5lqu 5lr6 5p8w

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5FHR)