Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
(-)Biological Unit 7
(-)Biological Unit 8
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)
Image Biological Unit 7
Biological Unit 7  (Jmol Viewer)
Image Biological Unit 8
Biological Unit 8  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF COMT IN COMPLEX WITH 2,4-DIMETHYL-5-[3-(1-PHENYLETHYL)-1H-PYRAZOL-5-YL]-1,3-THIAZOLE
 
Authors :  A. Ehler, R. M. Rodriguez-Sarmiento, M. G. Rudolph
Date :  17 May 16  (Deposition) - 07 Sep 16  (Release) - 21 Dec 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.36
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Biol. Unit 5:  E  (1x)
Biol. Unit 6:  F  (1x)
Biol. Unit 7:  G  (1x)
Biol. Unit 8:  H  (1x)
Keywords :  Methyltransferase, Neurotransmitter Degradation, Catechol, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Lerner, R. Jakob-Roetne, B. Buettelmann, A. Ehler, M. Rudolph, R. M. Rodriguez Sarmiento
Design Of Potent And Druglike Nonphenolic Inhibitors For Catechol O-Methyltransferase Derived From A Fragment Screening Approach Targeting The S-Adenosyl-L-Methionine Pocket.
J. Med. Chem. V. 59 10163 2016
PubMed-ID: 27685665  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.6B00927

(-) Compounds

Molecule 1 - CATECHOL O-METHYLTRANSFERASE
    Chains: A, B, C, D, E, F, G, H
    EC Number: 2.1.1.6
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: COMT
    Organism Common: NORWAY RAT
    Organism Scientific: RATTUS NORVEGICUS
    Organism Taxid: 10116

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit : ABCDEFGH
Biological Unit 1 (1x): A       
Biological Unit 2 (1x):  B      
Biological Unit 3 (1x):   C     
Biological Unit 4 (1x):    D    
Biological Unit 5 (1x):     E   
Biological Unit 6 (1x):      F  
Biological Unit 7 (1x):       G 
Biological Unit 8 (1x):        H

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (6, 48)

Asymmetric Unit (6, 48)
No.NameCountTypeFull Name
16PS8Ligand/Ion2,4-DIMETHYL-5-{3-[(1R)-1-PHENYLETHYL]-1H-PYRAZOL-5-YL}-1,3-THIAZOLE
2CL5Ligand/IonCHLORIDE ION
3CXS7Ligand/Ion3-CYCLOHEXYL-1-PROPYLSULFONIC ACID
4EDO3Ligand/Ion1,2-ETHANEDIOL
5K8Ligand/IonPOTASSIUM ION
6PO417Ligand/IonPHOSPHATE ION
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
16PS1Ligand/Ion2,4-DIMETHYL-5-{3-[(1R)-1-PHENYLETHYL]-1H-PYRAZOL-5-YL}-1,3-THIAZOLE
2CL-1Ligand/IonCHLORIDE ION
3CXS-1Ligand/Ion3-CYCLOHEXYL-1-PROPYLSULFONIC ACID
4EDO-1Ligand/Ion1,2-ETHANEDIOL
5K-1Ligand/IonPOTASSIUM ION
6PO43Ligand/IonPHOSPHATE ION
Biological Unit 2 (2, 5)
No.NameCountTypeFull Name
16PS1Ligand/Ion2,4-DIMETHYL-5-{3-[(1R)-1-PHENYLETHYL]-1H-PYRAZOL-5-YL}-1,3-THIAZOLE
2CL-1Ligand/IonCHLORIDE ION
3CXS-1Ligand/Ion3-CYCLOHEXYL-1-PROPYLSULFONIC ACID
4EDO-1Ligand/Ion1,2-ETHANEDIOL
5K-1Ligand/IonPOTASSIUM ION
6PO44Ligand/IonPHOSPHATE ION
Biological Unit 3 (4, 6)
No.NameCountTypeFull Name
16PS1Ligand/Ion2,4-DIMETHYL-5-{3-[(1R)-1-PHENYLETHYL]-1H-PYRAZOL-5-YL}-1,3-THIAZOLE
2CL-1Ligand/IonCHLORIDE ION
3CXS2Ligand/Ion3-CYCLOHEXYL-1-PROPYLSULFONIC ACID
4EDO1Ligand/Ion1,2-ETHANEDIOL
5K-1Ligand/IonPOTASSIUM ION
6PO42Ligand/IonPHOSPHATE ION
Biological Unit 4 (4, 5)
No.NameCountTypeFull Name
16PS1Ligand/Ion2,4-DIMETHYL-5-{3-[(1R)-1-PHENYLETHYL]-1H-PYRAZOL-5-YL}-1,3-THIAZOLE
2CL-1Ligand/IonCHLORIDE ION
3CXS1Ligand/Ion3-CYCLOHEXYL-1-PROPYLSULFONIC ACID
4EDO2Ligand/Ion1,2-ETHANEDIOL
5K-1Ligand/IonPOTASSIUM ION
6PO41Ligand/IonPHOSPHATE ION
Biological Unit 5 (3, 4)
No.NameCountTypeFull Name
16PS1Ligand/Ion2,4-DIMETHYL-5-{3-[(1R)-1-PHENYLETHYL]-1H-PYRAZOL-5-YL}-1,3-THIAZOLE
2CL-1Ligand/IonCHLORIDE ION
3CXS2Ligand/Ion3-CYCLOHEXYL-1-PROPYLSULFONIC ACID
4EDO-1Ligand/Ion1,2-ETHANEDIOL
5K-1Ligand/IonPOTASSIUM ION
6PO41Ligand/IonPHOSPHATE ION
Biological Unit 6 (3, 3)
No.NameCountTypeFull Name
16PS1Ligand/Ion2,4-DIMETHYL-5-{3-[(1R)-1-PHENYLETHYL]-1H-PYRAZOL-5-YL}-1,3-THIAZOLE
2CL-1Ligand/IonCHLORIDE ION
3CXS1Ligand/Ion3-CYCLOHEXYL-1-PROPYLSULFONIC ACID
4EDO-1Ligand/Ion1,2-ETHANEDIOL
5K-1Ligand/IonPOTASSIUM ION
6PO41Ligand/IonPHOSPHATE ION
Biological Unit 7 (2, 4)
No.NameCountTypeFull Name
16PS1Ligand/Ion2,4-DIMETHYL-5-{3-[(1R)-1-PHENYLETHYL]-1H-PYRAZOL-5-YL}-1,3-THIAZOLE
2CL-1Ligand/IonCHLORIDE ION
3CXS-1Ligand/Ion3-CYCLOHEXYL-1-PROPYLSULFONIC ACID
4EDO-1Ligand/Ion1,2-ETHANEDIOL
5K-1Ligand/IonPOTASSIUM ION
6PO43Ligand/IonPHOSPHATE ION
Biological Unit 8 (3, 4)
No.NameCountTypeFull Name
16PS1Ligand/Ion2,4-DIMETHYL-5-{3-[(1R)-1-PHENYLETHYL]-1H-PYRAZOL-5-YL}-1,3-THIAZOLE
2CL-1Ligand/IonCHLORIDE ION
3CXS1Ligand/Ion3-CYCLOHEXYL-1-PROPYLSULFONIC ACID
4EDO-1Ligand/Ion1,2-ETHANEDIOL
5K-1Ligand/IonPOTASSIUM ION
6PO42Ligand/IonPHOSPHATE ION

(-) Sites  (46, 46)

Asymmetric Unit (46, 46)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLY A:66 , MET A:89 , GLU A:90 , ILE A:91 , GLY A:117 , SER A:119 , GLN A:120 , ASP A:141 , HIS A:142 , TRP A:143 , ARG A:146binding site for residue 6PS A 301
02AC2SOFTWARESER A:186 , SER A:187 , HOH A:403 , HOH A:406 , HOH A:435 , SER C:216 , THR D:4 , LYS D:5 , GLU D:6 , CXS D:302binding site for residue PO4 A 302
03AC3SOFTWARETYR A:194 , HOH A:401 , HOH A:404 , HOH A:464 , TYR F:194 , HOH F:410binding site for residue PO4 A 303
04AC4SOFTWARETRP A:143 , LYS A:144 , HOH A:434binding site for residue PO4 A 304
05AC5SOFTWAREVAL A:183 , ARG A:184 , SER A:186 , PHE A:189 , HOH A:473 , TYR F:197binding site for residue K A 305
06AC6SOFTWARETYR A:197 , VAL F:183 , ARG F:184 , SER F:186 , PHE F:189 , HOH F:496binding site for residue K A 306
07AC7SOFTWAREMET B:40 , GLY B:66 , MET B:89 , GLU B:90 , ILE B:91 , GLY B:117 , ALA B:118 , SER B:119 , GLN B:120 , ASP B:141 , HIS B:142 , TRP B:143binding site for residue 6PS B 301
08AC8SOFTWARESER B:186 , SER B:187 , HOH B:404 , HOH B:405 , SER E:216 , THR H:4 , LYS H:5 , GLU H:6 , CXS H:302 , HOH H:433binding site for residue PO4 B 302
09AC9SOFTWARETYR B:194 , HOH B:444 , HOH B:458 , TYR G:194binding site for residue PO4 B 303
10AD1SOFTWARETRP B:143 , LYS B:144 , LYS F:129binding site for residue PO4 B 304
11AD2SOFTWAREGLY B:83 , ARG B:85 , LYS B:111binding site for residue PO4 B 305
12AD3SOFTWAREVAL B:183 , ARG B:184 , SER B:186 , PHE B:189 , HOH B:511 , TYR G:197binding site for residue K B 306
13AD4SOFTWARETYR B:197 , VAL G:183 , ARG G:184 , SER G:186 , PHE G:189 , HOH G:464binding site for residue K B 308
14AD5SOFTWAREGLY C:66 , MET C:89 , GLU C:90 , ILE C:91 , GLY C:117 , SER C:119 , GLN C:120 , HIS C:142 , TRP C:143binding site for residue 6PS C 301
15AD6SOFTWARELYS C:5 , GLU C:6 , ALA C:39 , MET C:40 , TYR C:68 , ASN C:92 , TYR C:200 , MET C:201 , LYS C:202 , PO4 C:305 , HOH C:420 , TYR F:182 , GLY F:185 , SER F:186binding site for residue CXS C 302
16AD7SOFTWARETHR C:176 , PRO C:177 , ASP C:178 , PHE C:179 , HOH C:444 , GLN D:120 , ARG D:146binding site for residue CXS C 303
17AD8SOFTWAREASN C:41 , VAL C:42 , LYS C:46 , ASP C:141 , ASP C:169 , ASN C:170 , HOH C:415 , HOH C:446 , HOH C:458binding site for residue EDO C 304
18AD9SOFTWARETHR C:4 , LYS C:5 , GLU C:6 , CXS C:302 , HOH C:406 , HOH C:420 , HOH C:452 , SER D:216 , SER F:186 , SER F:187binding site for residue PO4 C 305
19AE1SOFTWAREARG C:184 , PHE C:189 , GLU C:190 , CYS C:191 , K C:307 , HOH C:407 , HOH C:481binding site for residue PO4 C 306
20AE2SOFTWAREVAL C:183 , ARG C:184 , SER C:186 , PHE C:189 , PO4 C:306binding site for residue K C 307
21AE3SOFTWAREHOH C:486binding site for residue CL C 308
22AE4SOFTWAREGLY D:66 , MET D:89 , GLU D:90 , ILE D:91 , GLY D:117 , SER D:119 , GLN D:120 , HIS D:142 , TRP D:143binding site for residue 6PS D 301
23AE5SOFTWAREPO4 A:302 , HOH A:406 , LYS D:5 , GLU D:6 , ALA D:39 , MET D:40 , ASN D:92 , MET D:201 , LYS D:202binding site for residue CXS D 302
24AE6SOFTWARETRP D:143 , HOH D:408binding site for residue EDO D 303
25AE7SOFTWARELYS D:46 , ASP D:141 , ASP D:169 , ASN D:170 , LEU D:198binding site for residue EDO D 304
26AE8SOFTWARETHR D:176 , PRO D:177 , ASP D:178 , PHE D:179 , HOH D:427binding site for residue PO4 D 305
27AE9SOFTWAREARG D:184 , SER D:186 , PHE D:189binding site for residue K D 306
28AF1SOFTWAREMET E:40 , GLY E:66 , GLU E:90 , ILE E:91 , GLY E:117 , SER E:119 , GLN E:120 , HIS E:142 , TRP E:143binding site for residue 6PS E 301
29AF2SOFTWARELYS E:5 , GLU E:6 , ALA E:39 , MET E:40 , ASN E:92 , LYS E:202 , TYR G:182 , PO4 G:304 , HOH G:455binding site for residue CXS E 302
30AF3SOFTWARELEU A:10 , ARG E:184 , HIS E:193binding site for residue CXS E 303
31AF4SOFTWAREHIS E:193binding site for residue CL E 304
32AF5SOFTWAREGLY E:175 , THR E:176 , PRO E:177 , ASP E:178 , PHE E:179 , HOH E:418binding site for residue PO4 E 306
33AF6SOFTWAREVAL E:183 , ARG E:184 , SER E:186 , PHE E:189 , HOH E:437binding site for residue K E 307
34AF7SOFTWAREGLY F:66 , MET F:89 , GLU F:90 , ILE F:91 , GLY F:117 , ALA F:118 , SER F:119 , GLN F:120 , ASP F:141 , HIS F:142 , TRP F:143 , ARG F:146binding site for residue 6PS F 301
35AF8SOFTWARETRP F:143 , LYS F:144binding site for residue CXS F 302
36AF9SOFTWAREGLN F:120 , TRP F:143 , ARG F:146binding site for residue PO4 F 303
37AG1SOFTWAREGLY G:66 , TYR G:68 , MET G:89 , GLU G:90 , ILE G:91 , ALA G:118 , SER G:119 , GLN G:120 , HIS G:142 , TRP G:143 , ARG G:146 , PO4 G:302binding site for residue 6PS G 301
38AG2SOFTWARETRP G:143 , LYS G:144 , ASP G:145 , 6PS G:301binding site for residue PO4 G 302
39AG3SOFTWAREPRO G:82 , GLY G:83 , ARG G:85 , LYS G:111binding site for residue PO4 G 303
40AG4SOFTWARETHR E:4 , LYS E:5 , GLU E:6 , CXS E:302 , SER G:186 , SER G:187 , SER G:188 , HOH G:455 , SER H:216binding site for residue PO4 G 304
41AG5SOFTWAREGLY H:66 , TYR H:68 , MET H:89 , GLU H:90 , ILE H:91 , GLY H:117 , SER H:119 , GLN H:120 , HIS H:142 , TRP H:143binding site for residue 6PS H 301
42AG6SOFTWARETYR B:182 , SER B:186 , PO4 B:302 , HOH B:405 , LYS H:5 , GLU H:6 , ALA H:39 , MET H:40 , TYR H:68 , ASN H:92 , TYR H:200 , MET H:201 , LYS H:202binding site for residue CXS H 302
43AG7SOFTWAREHOH H:445binding site for residue CL H 303
44AG8SOFTWARETHR H:176 , PRO H:177 , ASP H:178 , PHE H:179 , HOH H:413 , HOH H:415binding site for residue PO4 H 304
45AG9SOFTWARESER C:58 , GLN C:81 , LEU H:180 , ALA H:181 , ARG H:184 , HOH H:408binding site for residue PO4 H 305
46AH1SOFTWAREVAL H:183 , ARG H:184 , SER H:186 , PHE H:189 , HOH H:448binding site for residue K H 306

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5K0B)

(-) Cis Peptide Bonds  (8, 8)

Asymmetric Unit
No.Residues
1Val A:173 -Pro A:174
2Val B:173 -Pro B:174
3Val C:173 -Pro C:174
4Val D:173 -Pro D:174
5Val E:173 -Pro E:174
6Val F:173 -Pro F:174
7Val G:173 -Pro G:174
8Val H:173 -Pro H:174

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5K0B)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5K0B)

(-) Exons   (0, 0)

(no "Exon" information available for 5K0B)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhh......eeeeee.hhhhhhhhhhhhhhhhhhh.eeeee.hhhhhh.hhhhhhh...eeeeee..hhhhhhhhhhhhhhh..eeeeeeeee.......hhhhhhhhhhh..eeeeeeeeeeeeeeeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5k0b A   3 DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS 216
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212    


Chain B from PDB  Type:PROTEIN  Length:215
                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhh......eeeeee.hhhhhhhhhhhhhhhhhhh.eeeee.hhhhhh.hhhhhh....eeeeee..hhhhhhhhhhhhhhh..eeeeeeeee.......hhhhhhhhhhh..eeeeeeeeeeeeeeeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5k0b B   2 GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS 216
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211     


Chain C from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhh......eeeeee.hhhhhhhhhhhhhhhhhhh.eeeee.hhhhhh.hhhhhh....eeeeee..hhhhhhhhhhhhhhh..eeeeeeeee.......hhhhhhhhhhh..eeeeeeeeeeeeeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5k0b C   3 DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSP 218
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212      


Chain D from PDB  Type:PROTEIN  Length:217
                                                                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhh......eeeeee.hhhhhhhhhhhhhhhh....eeeee.hhhhhh.hhhhhhh...eeeeee..hhhhhhhhhhhhhhh..eeeeeeeeee......hhhhhhhhhhh..eeeeeeeeeeeeeeeeeeeeeeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5k0b D   3 DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPS 219
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       


Chain E from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhh.....hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhh......eeeeee.hhhhhhhhhhhhhhhh....eeeee.hhhhhh.hhhhhh....eeeeee..hhhhhhhhhhhhhhh..eeeeeeeeee......hhhhhhhhhhh..eeeeeeeeeeeeeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5k0b E   3 DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSP 218
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212      


Chain F from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhh......eeeee..hhhhhhhhhhhhhhhhhhh.eeee..hhhhhh.hhhhhhh.....eeee..hhhhhhhhhhhhhhh.......eeee.......hhhhhhhhhhh..eeeeeeeeeeeeeeeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5k0b F   3 DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS 216
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212    


Chain G from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhh......eeeeee.hhhhhhhhhhhhhhhh....eeeee.hhhhhhhhh........eeeeee..hhhhhhhhhhhhhhh..eeeeeeeee.......hhhhhhhhhhh..eeeeeeeeeeeeeeeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5k0b G   3 DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS 216
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212    


Chain H from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhh.....hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhh......eeeeee.hhhhhhhhhhhhhhhh....eeeee.hhhhhh.hhhhhhh...eeeeee..hhhhhhhhhhhhhhh..eeeeeeeee.......hhhhhhhhhhh..eeeeeeeeeeeeeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5k0b H   3 DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSP 218
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5K0B)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5K0B)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5K0B)

(-) Gene Ontology  (42, 42)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    6PS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CXS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    K  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
    AG5  [ RasMol ]  +environment [ RasMol ]
    AG6  [ RasMol ]  +environment [ RasMol ]
    AG7  [ RasMol ]  +environment [ RasMol ]
    AG8  [ RasMol ]  +environment [ RasMol ]
    AG9  [ RasMol ]  +environment [ RasMol ]
    AH1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Val A:173 - Pro A:174   [ RasMol ]  
    Val B:173 - Pro B:174   [ RasMol ]  
    Val C:173 - Pro C:174   [ RasMol ]  
    Val D:173 - Pro D:174   [ RasMol ]  
    Val E:173 - Pro E:174   [ RasMol ]  
    Val F:173 - Pro F:174   [ RasMol ]  
    Val G:173 - Pro G:174   [ RasMol ]  
    Val H:173 - Pro H:174   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]
    Biological Unit 7  [ Jena3D ]
    Biological Unit 8  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format | Biol. Unit 5 PNG format | Biol. Unit 6 PNG format | Biol. Unit 7 PNG format | Biol. Unit 8 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5k0b
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  COMT_RAT | P22734
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.6
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  COMT_RAT | P22734
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        COMT_RAT | P22734: 1h1d 1jr4 1vid 2cl5 2zlb 2zth 2zvj 3a7d 3hvh 3hvi 3hvj 3hvk 3nw9 3nwb 3nwe 3oe4 3oe5 3ozr 3ozs 3ozt 3r6t 3s68 3u81 4p7g 4p7j 4p7k 4pyl 4pym 4pyn 4pyo 4pyq 5fhq 5fhr 5k01 5k03 5k05 5k09 5k0c 5k0e 5k0f 5k0g 5k0j 5k0l 5k0n 5lqa 5lqc 5lqj 5lqk 5lqn 5lqr 5lqu 5lr6 5p8w

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5K0B)