5K0C - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF COMT IN COMPLEX WITH 2,4-DIMETHYL-5-[3-(2-PHENYLPROPAN-2-YL)-1H-PYRAZOL-5-YL]-1,3-THIAZOLE

Authors :   A. Ehler, R. M. Rodriguez-Sarmiento, M. G. Rudolph

Date :   17 May 16 (Deposition) - 07 Sep 16 (Release) - 21 Dec 16 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.95

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Methyltransferase, Neurotransmitter Degradation, Catechol, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. Lerner, R. Jakob-Roetne, B. Buettelmann, A. Ehler, M. Rudolph, R. M. Rodriguez Sarmiento
Design Of Potent And Druglike Nonphenolic Inhibitors For Catechol O-Methyltransferase Derived From A Fragment Screening Approach Targeting The S-Adenosyl-L-Methionine Pocket.
J. Med. Chem. V. 59 10163 2016
PubMed-ID: 27685665 | Reference-DOI: 10.1021/ACS.JMEDCHEM.6B00927

Molecule 1 - CATECHOL O-METHYLTRANSFERASE
	Chains	:	A, B
	EC Number	:	2.1.1.6
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	COMT
	Organism Common	:	NORWAY RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (4, 10)

No.	Name	Count	Type	Full Name
1	6OZ	2	Ligand/Ion	2,4-DIMETHYL-5-[3-(2-PHENYLPROPAN-2-YL)-1H-PYRAZOL-5-YL]-1,3-THIAZOLE
2	EDO	2	Ligand/Ion	1,2-ETHANEDIOL
3	NA	4	Ligand/Ion	SODIUM ION
4	NHE	2	Ligand/Ion	2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID

Biological Unit 1 (3, 4)

No.	Name	Count	Type	Full Name
1	6OZ	1	Ligand/Ion	2,4-DIMETHYL-5-[3-(2-PHENYLPROPAN-2-YL)-1H-PYRAZOL-5-YL]-1,3-THIAZOLE
2	EDO	2	Ligand/Ion	1,2-ETHANEDIOL
3	NA	-1	Ligand/Ion	SODIUM ION
4	NHE	1	Ligand/Ion	2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID

Biological Unit 2 (2, 2)

No.	Name	Count	Type	Full Name
1	6OZ	1	Ligand/Ion	2,4-DIMETHYL-5-[3-(2-PHENYLPROPAN-2-YL)-1H-PYRAZOL-5-YL]-1,3-THIAZOLE
2	EDO	-1	Ligand/Ion	1,2-ETHANEDIOL
3	NA	-1	Ligand/Ion	SODIUM ION
4	NHE	1	Ligand/Ion	2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID

Asymmetric Unit (10, 10)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	TRP A:143 , LYS A:144 , ASP A:145 , HOH A:454 , LYS B:5 , GLU B:6 , TRP B:38 , ASN B:92 , 6OZ B:302 , HOH B:475	binding site for residue NHE A 301
02	AC2	SOFTWARE	ASN A:92 , HOH A:418 , HOH A:448 , ASN B:92	binding site for residue EDO A 302
03	AC3	SOFTWARE	ILE A:91 , GLN A:120 , ARG A:146 , HOH A:423	binding site for residue EDO A 303
04	AC4	SOFTWARE	GLY A:66 , MET A:89 , GLU A:90 , ILE A:91 , GLY A:117 , ALA A:118 , SER A:119 , GLN A:120 , HIS A:142 , TRP A:143 , ARG A:146 , NHE B:301 , 6OZ B:302	binding site for residue 6OZ A 304
05	AC5	SOFTWARE	ASP A:141 , ASP A:169 , ASN A:170 , HOH A:535 , HOH A:539	binding site for residue NA A 305
06	AC6	SOFTWARE	VAL A:183 , ARG A:184 , SER A:186 , PHE A:189 , HOH A:540 , HOH A:545	binding site for residue NA A 306
07	AC7	SOFTWARE	LYS A:5 , GLU A:6 , TRP A:38 , ASN A:92 , 6OZ A:304 , HOH A:474 , TRP B:143 , LYS B:144 , ASP B:145 , HOH B:452	binding site for residue NHE B 301
08	AC8	SOFTWARE	NHE A:301 , 6OZ A:304 , GLY B:66 , MET B:89 , GLU B:90 , ILE B:91 , GLY B:117 , ALA B:118 , SER B:119 , GLN B:120 , HIS B:142 , TRP B:143 , ARG B:146	binding site for residue 6OZ B 302
09	AC9	SOFTWARE	VAL B:183 , ARG B:184 , SER B:186 , PHE B:189 , HOH B:541 , HOH B:561	binding site for residue NA B 303
10	AD1	SOFTWARE	ASP B:141 , ASP B:169 , ASN B:170 , HOH B:498	binding site for residue NA B 304

(no "SS Bond" information available for 5K0C)

Asymmetric Unit

No.	Residues
1	Val A:173	-	Pro A:174
2	Val B:173	-	Pro B:174

(no "SAP(SNP)/Variant" information available for 5K0C)

(no "PROSITE Motif" information available for 5K0C)

(no "Exon" information available for 5K0C)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:215
                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh..eeeee....hhhhhhhhh......eeeeee.hhhhhhhhhhhhhhhh....eeeee.hhhhhh.hhhhhh....eeeeee..hhhhhhhhhhhhhhh..eeeeeeeee.......hhhhhhhhhhh..eeeeeeeeee....eeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5k0c A   2 GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS 216
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211

Chain B from PDB  Type:PROTEIN  Length:215
                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh..eeeee....hhhhhhhhh......eeeeee.hhhhhhhhhhhhhhhhhhh.eeeee.hhhhhh.hhhhhh....eeeeee..hhhhhhhhhhhhhhh..eeeeeeeee.......hhhhhhhhhhh..eeeeeeeee......eeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5k0c B   2 GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS 216
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 5K0C)

(no "CATH Domain" information available for 5K0C)

(no "Pfam Domain" information available for 5K0C)

Asymmetric Unit(hide GO term definitions)

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		6OZ	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NHE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Val A:173 - Pro A:174	[ RasMol ]
		Val B:173 - Pro B:174	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	5k0c
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	COMT_RAT \| P22734
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.1.1.6
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	COMT_RAT \| P22734
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 5K0C)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 10)

Sites (10, 10)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (42, 42)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File