Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE PERCHLORATE REDUCTASE PCRAB - SUBSTRATE ANALOG SEO3 BOUND - FROM AZOSPIRA SUILLUM PS
 
Authors :  C. -L. Tsai, J. A. Tainer
Date :  10 Jul 15  (Deposition) - 09 Mar 16  (Release) - 11 May 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.38
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  E,F  (1x)
Keywords :  Electron-Shuttling Protein, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. D. Youngblut, C. L. Tsai, I. C. Clark, H. K. Carlson, A. P. Maglaqui, P. S. Gau-Pan, S. A. Redford, A. Wong, J. A. Tainer, J. D. Coates
Perchlorate Reductase Is Distinguished By Active Site Aromatic Gate Residues.
J. Biol. Chem. V. 291 9190 2016
PubMed-ID: 26940877  |  Reference-DOI: 10.1074/JBC.M116.714618

(-) Compounds

Molecule 1 - DMSO REDUCTASE FAMILY TYPE II ENZYME, MOLYBDOPTERIN SUBUNIT
    Chains: A, C, E
    Organism Scientific: AZOSPIRA ORYZAE (STRAIN ATCC BAA-33 / DSM 13638 / PS)
    Organism Taxid: 640081
    Strain: ATCC BAA-33 / DSM 13638 / PS
 
Molecule 2 - DMSO REDUCTASE FAMILY TYPE II ENZYME, IRON-SULFUR SUBUNIT
    Chains: B, D, F
    Organism Scientific: AZOSPIRA ORYZAE (STRAIN ATCC BAA-33 / DSM 13638 / PS)
    Organism Taxid: 640081
    Strain: ATCC BAA-33 / DSM 13638 / PS

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABCDEF
Biological Unit 1 (1x): AB    
Biological Unit 2 (1x):   CD  
Biological Unit 3 (1x):     EF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (11, 66)

Asymmetric Unit (11, 66)
No.NameCountTypeFull Name
1BSY3Ligand/IonBISELENITE ION
2EDO24Ligand/Ion1,2-ETHANEDIOL
3F3S3Ligand/IonFE3-S4 CLUSTER
4GOL1Ligand/IonGLYCEROL
5MD13Ligand/IonPHOSPHORIC ACID 4-(2-AMINO-4-OXO-3,4,5,6,-TETRAHYDRO-PTERIDIN-6-YL)-2-HYDROXY-3,4-DIMERCAPTO-BUT-3-EN-YLESTER GUANYLATE ESTER
6MGD3Ligand/Ion2-AMINO-5,6-DIMERCAPTO-7-METHYL-3,7,8A,9-TETRAHYDRO-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-4-ONE GUANOSINEDINUCLEOTIDE
7MO3Ligand/IonMOLYBDENUM ATOM
8NA8Ligand/IonSODIUM ION
9SF412Ligand/IonIRON/SULFUR CLUSTER
10SO33Ligand/IonSULFITE ION
11ZN3Ligand/IonZINC ION
Biological Unit 1 (7, 24)
No.NameCountTypeFull Name
1BSY1Ligand/IonBISELENITE ION
2EDO15Ligand/Ion1,2-ETHANEDIOL
3F3S1Ligand/IonFE3-S4 CLUSTER
4GOL-1Ligand/IonGLYCEROL
5MD11Ligand/IonPHOSPHORIC ACID 4-(2-AMINO-4-OXO-3,4,5,6,-TETRAHYDRO-PTERIDIN-6-YL)-2-HYDROXY-3,4-DIMERCAPTO-BUT-3-EN-YLESTER GUANYLATE ESTER
6MGD1Ligand/Ion2-AMINO-5,6-DIMERCAPTO-7-METHYL-3,7,8A,9-TETRAHYDRO-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-4-ONE GUANOSINEDINUCLEOTIDE
7MO-1Ligand/IonMOLYBDENUM ATOM
8NA-1Ligand/IonSODIUM ION
9SF44Ligand/IonIRON/SULFUR CLUSTER
10SO31Ligand/IonSULFITE ION
11ZN-1Ligand/IonZINC ION
Biological Unit 2 (7, 14)
No.NameCountTypeFull Name
1BSY1Ligand/IonBISELENITE ION
2EDO5Ligand/Ion1,2-ETHANEDIOL
3F3S1Ligand/IonFE3-S4 CLUSTER
4GOL-1Ligand/IonGLYCEROL
5MD11Ligand/IonPHOSPHORIC ACID 4-(2-AMINO-4-OXO-3,4,5,6,-TETRAHYDRO-PTERIDIN-6-YL)-2-HYDROXY-3,4-DIMERCAPTO-BUT-3-EN-YLESTER GUANYLATE ESTER
6MGD1Ligand/Ion2-AMINO-5,6-DIMERCAPTO-7-METHYL-3,7,8A,9-TETRAHYDRO-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-4-ONE GUANOSINEDINUCLEOTIDE
7MO-1Ligand/IonMOLYBDENUM ATOM
8NA-1Ligand/IonSODIUM ION
9SF44Ligand/IonIRON/SULFUR CLUSTER
10SO31Ligand/IonSULFITE ION
11ZN-1Ligand/IonZINC ION
Biological Unit 3 (8, 14)
No.NameCountTypeFull Name
1BSY1Ligand/IonBISELENITE ION
2EDO4Ligand/Ion1,2-ETHANEDIOL
3F3S1Ligand/IonFE3-S4 CLUSTER
4GOL1Ligand/IonGLYCEROL
5MD11Ligand/IonPHOSPHORIC ACID 4-(2-AMINO-4-OXO-3,4,5,6,-TETRAHYDRO-PTERIDIN-6-YL)-2-HYDROXY-3,4-DIMERCAPTO-BUT-3-EN-YLESTER GUANYLATE ESTER
6MGD1Ligand/Ion2-AMINO-5,6-DIMERCAPTO-7-METHYL-3,7,8A,9-TETRAHYDRO-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-4-ONE GUANOSINEDINUCLEOTIDE
7MO-1Ligand/IonMOLYBDENUM ATOM
8NA-1Ligand/IonSODIUM ION
9SF44Ligand/IonIRON/SULFUR CLUSTER
10SO31Ligand/IonSULFITE ION
11ZN-1Ligand/IonZINC ION

(-) Sites  (66, 66)

Asymmetric Unit (66, 66)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:32 , CYS A:36 , CYS A:40 , GLY A:73 , CYS A:74 , HOH A:1336binding site for residue SF4 A 1001
02AC2SOFTWAREASP A:170 , MGD A:1003 , MD1 A:1004 , BSY A:1013binding site for residue MO A 1002
03AC3SOFTWAREASN A:35 , LYS A:76 , ASP A:170 , TRP A:200 , GLY A:201 , SER A:202 , ASN A:203 , GLN A:206 , THR A:207 , ILE A:228 , PRO A:230 , ASP A:231 , ASN A:233 , GLY A:248 , ASP A:250 , GLY A:421 , GLY A:422 , GLY A:423 , TRP A:427 , ILE A:458 , GLY A:459 , ASN A:761 , PRO A:763 , HIS A:764 , SER A:765 , ARG A:766 , SER A:768 , VAL A:769 , HIS A:770 , ARG A:830 , HIS A:835 , ARG A:882 , MO A:1002 , MD1 A:1004 , BSY A:1013 , HOH A:1130 , HOH A:1148 , HOH A:1197 , HOH A:1221 , HOH A:1287 , HOH A:1301 , HOH A:1326binding site for residue MGD A 1003
04AC4SOFTWARELEU A:33 , ASN A:35 , TYR A:168 , ASP A:170 , HIS A:426 , ARG A:537 , GLY A:538 , ASN A:539 , GLN A:543 , ILE A:564 , ASN A:565 , ILE A:566 , ARG A:567 , ASP A:569 , SER A:581 , TRP A:584 , LYS A:587 , ASP A:615 , SER A:762 , HIS A:764 , VAL A:769 , HIS A:770 , SER A:771 , THR A:772 , HIS A:835 , GLN A:849 , GLN A:881 , ARG A:882 , MO A:1002 , MGD A:1003 , BSY A:1013 , HOH A:1210 , HOH A:1240 , HOH A:1251 , HOH A:1254binding site for residue MD1 A 1004
05AC5SOFTWAREILE A:243 , HIS A:244 , VAL A:398 , THR A:399 , HOH A:1122 , HOH A:1236binding site for residue EDO A 1005
06AC6SOFTWARELYS A:462 , THR A:593 , SER A:594 , HIS A:596 , ASN A:697 , TYR A:708 , HOH A:1151 , HOH A:1193binding site for residue EDO A 1006
07AC7SOFTWAREPHE A:192 , SER A:194 , ALA A:218 , ASN A:221binding site for residue EDO A 1007
08AC8SOFTWAREASN A:804 , PRO A:896 , THR B:109 , PRO B:110binding site for residue EDO A 1008
09AC9SOFTWARELYS A:58 , ILE A:60 , ALA A:61 , LYS A:690binding site for residue EDO A 1009
10AD1SOFTWAREARG A:96 , GLY A:98 , GLU A:99 , ARG A:100 , GLY A:101 , GLU A:102 , GLY A:103 , LYS A:104 , TRP A:105 , LEU A:573 , SER A:575binding site for residue EDO A 1010
11AD2SOFTWAREGLU A:495 , ASN A:553 , HOH A:1164 , HOH A:1252 , TRP C:806 , ARG D:103binding site for residue EDO A 1011
12AD3SOFTWARESER A:792 , PRO A:793 , ASN A:824 , GLU A:826 , GLU B:124 , TYR B:125 , HOH B:564binding site for residue EDO A 1012
13AD4SOFTWAREASN A:35 , VAL A:139 , PHE A:164 , TYR A:165 , TYR A:168 , ASP A:170 , GLY A:459 , MO A:1002 , MGD A:1003 , MD1 A:1004binding site for residue BSY A 1013
14AD5SOFTWAREVAL A:51 , ZN A:1017 , HOH A:1114 , HOH A:1177binding site for residue SO3 A 1014
15AD6SOFTWAREVAL A:777binding site for residue NA A 1015
16AD7SOFTWAREHIS A:128 , GLU A:559 , HOH A:1412binding site for residue NA A 1016
17AD8SOFTWAREHIS A:81 , SO3 A:1014 , HOH A:1166 , HOH B:506binding site for residue ZN A 1017
18AD9SOFTWAREPHE A:9 , TYR A:11 , GLU A:15 , ARG B:157 , GLU B:158 , GLN B:159binding site for residue EDO A 1018
19AE1SOFTWARETRP A:806 , HOH A:1172 , HOH A:1339 , ARG B:103 , EDO B:409 , GLU E:495 , ASN E:553binding site for residue EDO A 1019
20AE2SOFTWARECYS B:149 , ASN B:151 , CYS B:170 , LYS B:171 , GLY B:172 , ALA B:173 , GLN B:174 , ALA B:175 , CYS B:176 , ALA B:194binding site for residue F3S B 401
21AE3SOFTWARECYS B:137 , ASN B:138 , CYS B:140 , CYS B:145 , CYS B:180binding site for residue SF4 B 402
22AE4SOFTWARECYS B:21 , ILE B:22 , CYS B:24 , GLN B:25 , CYS B:27 , ARG B:47 , CYS B:216 , VAL B:217 , GLY B:218binding site for residue SF4 B 403
23AE5SOFTWARETYR B:14 , CYS B:31 , TRP B:35 , ARG B:47 , CYS B:197 , ILE B:198 , GLY B:199 , CYS B:200 , CYS B:212binding site for residue SF4 B 404
24AE6SOFTWAREILE B:82 , GLY B:85 , ILE B:86 , PHE B:88 , THR B:109 , PRO B:110 , ARG B:111 , SER B:112binding site for residue EDO B 405
25AE7SOFTWAREGLY B:102binding site for residue NA B 406
26AE8SOFTWAREVAL B:223 , SER B:231 , SER B:232 , VAL B:233 , ASP B:326 , MET B:327binding site for residue EDO B 407
27AE9SOFTWAREPRO A:71 , VAL B:213 , ALA B:214 , CYS B:216 , ARG B:219 , ALA B:220 , MET B:221 , MET B:327 , MET B:328binding site for residue EDO B 408
28AF1SOFTWARETRP A:806 , ARG A:819 , ASP A:842 , EDO A:1019 , HOH A:1172 , ARG B:103 , ARG B:105 , PRO B:106binding site for residue EDO B 409
29AF2SOFTWARETHR B:28 , CYS B:31 , LYS B:32 , THR B:36 , MET B:44 , TYR B:45 , TRP B:46 , ARG B:47binding site for residue EDO B 410
30AF3SOFTWAREHIS C:32 , CYS C:36 , CYS C:40 , GLY C:73 , CYS C:74 , GLY C:77binding site for residue SF4 C 1001
31AF4SOFTWAREASP C:170 , MGD C:1003 , MD1 C:1004 , BSY C:1009binding site for residue MO C 1002
32AF5SOFTWARELYS C:76 , ASP C:170 , GLY C:201 , ASN C:203 , GLN C:206 , THR C:207 , ARG C:208 , ILE C:228 , SER C:229 , PRO C:230 , ASP C:231 , ASN C:233 , GLY C:248 , ASP C:250 , GLY C:421 , GLY C:422 , GLY C:423 , TRP C:427 , TYR C:457 , ILE C:458 , GLY C:459 , ASN C:761 , PRO C:763 , HIS C:764 , SER C:765 , ARG C:766 , SER C:768 , VAL C:769 , HIS C:770 , ARG C:830 , ARG C:882 , MO C:1002 , MD1 C:1004 , BSY C:1009 , HOH C:1120binding site for residue MGD C 1003
33AF6SOFTWARELEU C:33 , ASN C:35 , TYR C:168 , ASP C:170 , HIS C:426 , TYR C:536 , ARG C:537 , GLY C:538 , ASN C:539 , GLN C:543 , ILE C:564 , ASN C:565 , ARG C:567 , ASP C:569 , SER C:581 , TRP C:584 , LYS C:587 , ASP C:615 , SER C:762 , HIS C:764 , VAL C:769 , HIS C:770 , SER C:771 , THR C:772 , HIS C:835 , GLN C:849 , GLN C:881 , ARG C:882 , MO C:1002 , MGD C:1003 , BSY C:1009 , HOH C:1138 , HOH C:1181 , HOH C:1203 , HOH C:1206binding site for residue MD1 C 1004
34AF7SOFTWAREILE C:751 , ASP C:752 , ALA C:753 , HOH C:1115binding site for residue EDO C 1005
35AF8SOFTWAREALA C:61 , PRO C:62 , MET C:63 , ILE C:66 , PRO C:67 , GLU C:68 , TYR C:69binding site for residue EDO C 1006
36AF9SOFTWAREGLU C:495 , ASN C:553 , HOH C:1300 , HOH C:1327 , TRP E:806 , ARG F:103binding site for residue EDO C 1007
37AG1SOFTWAREARG C:96 , HOH C:1109binding site for residue EDO C 1008
38AG2SOFTWAREASN C:35 , PHE C:164 , TYR C:165 , TYR C:168 , ASP C:170 , ILE C:458 , GLY C:459 , MO C:1002 , MGD C:1003 , MD1 C:1004binding site for residue BSY C 1009
39AG3SOFTWAREVAL C:51 , HIS C:81 , TYR C:85 , ZN C:1013binding site for residue SO3 C 1010
40AG4SOFTWAREVAL C:777 , HOH C:1328binding site for residue NA C 1011
41AG5SOFTWAREHIS C:128 , GLU C:559binding site for residue NA C 1012
42AG6SOFTWAREHIS C:81 , SO3 C:1010 , HOH D:527binding site for residue ZN C 1013
43AG7SOFTWARECYS D:149 , CYS D:170 , LYS D:171 , GLY D:172 , ALA D:173 , GLN D:174 , ALA D:175 , CYS D:176 , ALA D:194binding site for residue F3S D 401
44AG8SOFTWARECYS D:137 , ASN D:138 , CYS D:140 , CYS D:145 , CYS D:180 , TYR D:182binding site for residue SF4 D 402
45AG9SOFTWARECYS D:21 , ILE D:22 , GLY D:23 , CYS D:24 , GLN D:25 , CYS D:27 , ARG D:47 , CYS D:216binding site for residue SF4 D 403
46AH1SOFTWARECYS D:31 , TRP D:35 , ARG D:47 , MET D:136 , CYS D:197 , GLY D:199 , CYS D:200 , CYS D:212binding site for residue SF4 D 404
47AH2SOFTWAREGLY D:85 , ILE D:86 , PHE D:88 , PRO D:108 , THR D:109 , PRO D:110 , ARG D:111 , SER D:112binding site for residue EDO D 405
48AH3SOFTWAREHIS E:32 , CYS E:36 , ALA E:39 , CYS E:40 , GLY E:73 , CYS E:74 , GLY E:77 , HOH E:1259binding site for residue SF4 E 1001
49AH4SOFTWAREASP E:170 , MGD E:1003 , MD1 E:1004 , BSY E:1008binding site for residue MO E 1002
50AH5SOFTWARELYS E:76 , ASP E:170 , TRP E:200 , GLY E:201 , ASN E:203 , GLN E:206 , THR E:207 , ARG E:208 , ILE E:228 , PRO E:230 , ASP E:231 , ASN E:233 , GLY E:248 , ASP E:250 , GLY E:421 , GLY E:422 , GLY E:423 , TRP E:427 , ILE E:458 , GLY E:459 , ASN E:761 , PRO E:763 , HIS E:764 , SER E:765 , ARG E:766 , SER E:768 , VAL E:769 , HIS E:770 , ARG E:830 , ARG E:882 , MO E:1002 , MD1 E:1004 , BSY E:1008 , HOH E:1142 , HOH E:1170 , HOH E:1273binding site for residue MGD E 1003
51AH6SOFTWARELEU E:33 , ASN E:35 , TYR E:168 , ASP E:170 , HIS E:426 , TYR E:536 , ARG E:537 , GLY E:538 , ASN E:539 , GLN E:543 , LYS E:545 , ILE E:564 , ASN E:565 , ARG E:567 , ASP E:569 , SER E:581 , TRP E:584 , LYS E:587 , ASP E:615 , SER E:762 , HIS E:764 , VAL E:769 , HIS E:770 , SER E:771 , THR E:772 , HIS E:835 , GLN E:849 , GLN E:881 , ARG E:882 , MO E:1002 , MGD E:1003 , BSY E:1008 , HOH E:1134 , HOH E:1189 , HOH E:1211 , HOH E:1225binding site for residue MD1 E 1004
52AH7SOFTWARETHR E:185 , LYS E:462 , THR E:593 , SER E:594 , HIS E:596 , ASN E:697 , TYR E:708binding site for residue EDO E 1005
53AH8SOFTWAREARG E:107 , GLU E:611 , HOH E:1113 , HOH E:1160 , HOH E:1292binding site for residue GOL E 1006
54AH9SOFTWAREARG E:96 , ASP E:576 , HOH E:1206binding site for residue EDO E 1007
55AI1SOFTWAREASN E:35 , PHE E:164 , TYR E:165 , TYR E:168 , ASP E:170 , ILE E:458 , GLY E:459 , MO E:1002 , MGD E:1003 , MD1 E:1004binding site for residue BSY E 1008
56AI2SOFTWAREVAL E:51 , ZN E:1013binding site for residue SO3 E 1009
57AI3SOFTWAREVAL E:777binding site for residue NA E 1010
58AI4SOFTWAREGLY E:538 , ASP E:563 , ASN E:565 , ASP E:569binding site for residue NA E 1011
59AI5SOFTWAREHIS E:128 , GLU E:559binding site for residue NA E 1012
60AI6SOFTWAREHIS E:81 , SO3 E:1009 , HOH F:565binding site for residue ZN E 1013
61AI7SOFTWARECYS F:149 , ASN F:151 , CYS F:170 , LYS F:171 , GLY F:172 , ALA F:173 , GLN F:174 , ALA F:175 , CYS F:176binding site for residue F3S F 401
62AI8SOFTWARECYS F:137 , ASN F:138 , CYS F:140 , CYS F:145 , CYS F:180binding site for residue SF4 F 402
63AI9SOFTWARECYS F:21 , ILE F:22 , CYS F:24 , GLN F:25 , CYS F:27 , ARG F:47 , CYS F:216 , GLY F:218binding site for residue SF4 F 403
64AJ1SOFTWARECYS F:31 , TRP F:35 , ARG F:47 , CYS F:197 , GLY F:199 , CYS F:200 , CYS F:212binding site for residue SF4 F 404
65AJ2SOFTWAREGLY F:85 , ILE F:86 , PHE F:88 , THR F:109 , PRO F:110 , ARG F:111 , SER F:112binding site for residue EDO F 405
66AJ3SOFTWAREGLU F:89 , ASP F:91 , ARG F:105 , SER F:107binding site for residue EDO F 406

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5CHC)

(-) Cis Peptide Bonds  (22, 22)

Asymmetric Unit
No.Residues
1Asn A:70 -Pro A:71
2Lys A:414 -Pro A:415
3Met A:523 -Pro A:524
4Ala B:52 -Pro B:53
5Tyr B:57 -Pro B:58
6Ser B:107 -Pro B:108
7Tyr B:125 -Pro B:126
8Asn C:70 -Pro C:71
9Asp C:366 -Gly C:367
10Lys C:414 -Pro C:415
11Met C:523 -Pro C:524
12Ala D:52 -Pro D:53
13Tyr D:57 -Pro D:58
14Ser D:107 -Pro D:108
15Tyr D:125 -Pro D:126
16Asn E:70 -Pro E:71
17Lys E:414 -Pro E:415
18Met E:523 -Pro E:524
19Ala F:52 -Pro F:53
20Tyr F:57 -Pro F:58
21Ser F:107 -Pro F:108
22Tyr F:125 -Pro F:126

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5CHC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5CHC)

(-) Exons   (0, 0)

(no "Exon" information available for 5CHC)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:895
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhh...eeeee...........eeeeee..eeeeeee...................hhhhhhhhhhh.......eee........eee.hhhhhhhhhhhhhhhhhhhhhhh.eeee..hhhhhhhhhhhhhhhhhhhh.ee..........hhhhhhhhh......hhhhhhhh.eeeee..hhhhhh...hhhhhhhhhh..eeeee....hhhhhhh.eee.....hhhhhhhhhhhhhhhh...hhhhhhhhh....eee.......hhhhh..........ee......ee......................hhhhh.................eeee.....eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh..eeeeehhhhhh..hhhhhhhhhhhhhhhh........eeee........hhhhhhhhhh..hhhhhee.hhhhhhhhhh...........hhhhhhhhhhhh......hhhhh...eeeee..hhhhhh.hhhhhhhhhhhhh.eeeeee...hhhhhh..eeee..hhhhh.eee......eeeee...........hhhhhhhhhhhhhhhhhhhh...eeee....eeee..hhhhhhhh.....hhhhhhhhhhhh.......hhhhhhhh.ee.................hhhhhh.................hhhhhhhh................eeee..............hhhhhhh......eeehhhhhh........eeeeee..eeeeeeeee.......eeee.............hhhhhh....hhhhhh......................eeeeee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5chc A   5 ISGAFEYSGWENFHRTQWSWDKKTRGAHLVNCTGACPHFVYSKDGVVMREEQSKDIAPMPNIPEYNPRGCNKGECGHDYMYGPHRIKYPLIRVGERGEGKWRRATWEEALDMIADKCVDTIKNHAPDCISVYSPVPAVSPVSFSAGHRFAHYIGAHAHTFYDWYGDHPTGQTQTCGVQGDTCETADWFNSKYIILWGSNPTQTRIPDAHFLSEAQLNGAKIVSISPDYNSSTIKVDKWIHPQPGTDGALAMAMAHVIIKEKLYDAHSLKEQTDLSYLVRSDTKRFLREADVVAGGSKDKFYFWNAKTGKPVIPKGSWGDQPEKKGSPVGFLGRNTFAFPKGYIDLGDLDPALEGKFNMQLLDGKTVEVRPVFEILKSRLMADNTPEKAAKITGVTAKAITELAREFATAKPSMIICGGGTQHWYYSDVLLRAMHLLTALTGTEGTNGGGMNHYIGQWKPAFVAGLVALAFPEGVNKQRFCQTTIWTYIHAEVNDEIISSDIDTEKYLRDSITTGQMPNMPEQGRDPKVFFVYRGNWLNQAKGQKYVLENLWPKLELIVDINIRMDSTALYSDVVLPSAHWYEKLDLNVTSEHSYINMTEPAIKPMWESKTDWQIFLALAKRVEMAAKRKKYEKFNDEKFKWVRDLSNLWNQMTMDGKLAEDEAAAQYILDNAPQSKGITIQMLREKPQRFKSNWTSPLKEGVPYTPFQYFVVDKKPWPTLTGRQQFYLDHDTFFDMGVELPTYKAPIDADKYPFRFNSPHSRHSVHSTFKDNVLMLRLQRGGPSIEMSPLDAKPLGIKDNDWVEAWNNHGKVICRVKIRNGEQRGRVSMWHCPELYMDLLTGGSQSVCPVRINPTNLVGNYGHLFFRPNYYGPAGSQRDVRVNVKRYIGATPISF 899
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634       644       654       664       674       684       694       704       714       724       734       744       754       764       774       784       794       804       814       824       834       844       854       864       874       884       894     


Chain B from PDB  Type:PROTEIN  Length:329
                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeee.......hhhhhhhhhhhh...........eeeee.......hhhhh...ee..ee......hhhhhh.....hhhhhhh.................................eeeee.......hhhhhhh....eee......eee........hhhhhhh.....eee....eee....hhhhhhh...hhhhhh.....eeeee.....hhhhhhhh.....ee.hhhhh....eeee......eee.....eeeee..hhhhhhhhhh.hhhhhhhhhhhhhhhhhh...hhhhhhhhh.hhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5chc B   5 MKAPRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPGLGYPRNWQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRVRPSPTPRSAPNWDEDQGAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAIYKREQDGIVVIHQDKCKGAQACVQSCPYAKPYFNPLTNKANKCIGCFPRIEQGVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQYKVALPLHPEFGTEPNVFYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAILQSEREKKMKGLASDLMDVLIGRRSTDMMISPLT 333
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324         


Chain C from PDB  Type:PROTEIN  Length:892
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhh....eeee...........eeee.......eeee...................hhhhhhhhhhh.......eee........eee.hhhhhhhhhhhhhhhhhhhhhhh.eeee..hhhhhhhhhhhhhhhhhhhh.............hhhhhhhhh......hhhhhhhh.eeeee..hhhhhh..hhhhhhhhhhh..eeeee....hhhhhhh.eee.....hhhhhhhhhhhhhhhh...hhhhhhhhh....eee.......hhhhhh.........ee......ee......................hhhhh.................eeee.....eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh..eeeeehhhhhh..hhhhhhhhhhhhhhhh........eeee........hhhhhhhhhh..hhhhh...hhhhhhhhhh...........hhhhhhhhhhhh......hhhhh...eeeee..hhhhhh.hhhhhhhhhhhhh.eeeeee...hhhhhh..eeee..hhhhh.eee......eeeee...........hhhhhhhhhhhhhhhhhhhh...eeeehhhheeee..hhhhhhhh.....hhhhhhhhhhhh.......hhhhhhhh.ee.................hhhhhh.................hhhhhhh.................eeee..............hhhhhhh......eeehhhhhhhhh.....eeeeee..eeeeeeeee.......eeee.............hhhhhh....hhhhhh......................eeeeee......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5chc C   8 AFEYSGWENFHRTQWSWDKKTRGAHLVNCTGACPHFVYSKDGVVMREEQSKDIAPMPNIPEYNPRGCNKGECGHDYMYGPHRIKYPLIRVGERGEGKWRRATWEEALDMIADKCVDTIKNHAPDCISVYSPVPAVSPVSFSAGHRFAHYIGAHAHTFYDWYGDHPTGQTQTCGVQGDTCETADWFNSKYIILWGSNPTQTRIPDAHFLSEAQLNGAKIVSISPDYNSSTIKVDKWIHPQPGTDGALAMAMAHVIIKEKLYDAHSLKEQTDLSYLVRSDTKRFLREADVVAGGSKDKFYFWNAKTGKPVIPKGSWGDQPEKKGSPVGFLGRNTFAFPKGYIDLGDLDPALEGKFNMQLLDGKTVEVRPVFEILKSRLMADNTPEKAAKITGVTAKAITELAREFATAKPSMIICGGGTQHWYYSDVLLRAMHLLTALTGTEGTNGGGMNHYIGQWKPAFVAGLVALAFPEGVNKQRFCQTTIWTYIHAEVNDEIISSDIDTEKYLRDSITTGQMPNMPEQGRDPKVFFVYRGNWLNQAKGQKYVLENLWPKLELIVDINIRMDSTALYSDVVLPSAHWYEKLDLNVTSEHSYINMTEPAIKPMWESKTDWQIFLALAKRVEMAAKRKKYEKFNDEKFKWVRDLSNLWNQMTMDGKLAEDEAAAQYILDNAPQSKGITIQMLREKPQRFKSNWTSPLKEGVPYTPFQYFVVDKKPWPTLTGRQQFYLDHDTFFDMGVELPTYKAPIDADKYPFRFNSPHSRHSVHSTFKDNVLMLRLQRGGPSIEMSPLDAKPLGIKDNDWVEAWNNHGKVICRVKIRNGEQRGRVSMWHCPELYMDLLTGGSQSVCPVRINPTNLVGNYGHLFFRPNYYGPAGSQRDVRVNVKRYIGATPISF 899
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667       677       687       697       707       717       727       737       747       757       767       777       787       797       807       817       827       837       847       857       867       877       887       897  


Chain D from PDB  Type:PROTEIN  Length:328
                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeee.......hhhhhhhhhhh............eeeee.......hhhhh...ee..ee......hhhhhh.....hhhhhhh.................................eeeee.......hhhhhhh....eee......eee........hhhhhhh.....ee......ee....hhhhhh....hhhhhh.....eeeee.....hhhhhhhh.....ee.hhhhh....eeee......eee.....eeeee..hhhhhhhhhh.hhhhhhhhhhhhhhhhhh...hhhhhhhhh.hhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5chc D   6 KAPRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPGLGYPRNWQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRVRPSPTPRSAPNWDEDQGAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAIYKREQDGIVVIHQDKCKGAQACVQSCPYAKPYFNPLTNKANKCIGCFPRIEQGVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQYKVALPLHPEFGTEPNVFYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAILQSEREKKMKGLASDLMDVLIGRRSTDMMISPLT 333
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325        


Chain E from PDB  Type:PROTEIN  Length:892
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh...eeeee...........eeeeee..eeeeeee...................hhhhhhhhhhh.......eee........eee.hhhhhhhhhhhhhhhhhhhhhhh.eeee..hhhhhhhhhhhhhhhhhhhh.ee..........hhhhhhhhh......hhhhhhhh.eeeee..hhhhhh...hhhhhhhhhh..eeeee....hhhhhhh.eee.....hhhhhhhhhhhhhhhh...hhhhhhhhh....eee.......hhhhhh.........ee......ee......................hhhhh.................eeee.....eeeeeehhhhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhhhhhhh..eeeeehhhhhh..hhhhhhhhhhhhhhhh........eeee........hhhhhhhhhh..hhhhh...hhhhhhhhhh...........hhhhhhhhhhhh..............eeeee..hhhhhh.hhhhhhhhhhhhh.eeeeee...hhhhhh..eeee..hhhhh.eee......eeeee...........hhhhhhhhhhhhhhhhhhhh...eeeehhhheeee..hhhhhhhh.....hhhhhhhhhhhh.......hhhhhhhh.ee.................hhhhhh.................hhhhhhh.................eeee..............hhhhhhh......eeehhhhhhhhh.....eeeee....eeeeeeee.......eeee.............hhhhhh....hhhhhh......................eeeeee......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5chc E   8 AFEYSGWENFHRTQWSWDKKTRGAHLVNCTGACPHFVYSKDGVVMREEQSKDIAPMPNIPEYNPRGCNKGECGHDYMYGPHRIKYPLIRVGERGEGKWRRATWEEALDMIADKCVDTIKNHAPDCISVYSPVPAVSPVSFSAGHRFAHYIGAHAHTFYDWYGDHPTGQTQTCGVQGDTCETADWFNSKYIILWGSNPTQTRIPDAHFLSEAQLNGAKIVSISPDYNSSTIKVDKWIHPQPGTDGALAMAMAHVIIKEKLYDAHSLKEQTDLSYLVRSDTKRFLREADVVAGGSKDKFYFWNAKTGKPVIPKGSWGDQPEKKGSPVGFLGRNTFAFPKGYIDLGDLDPALEGKFNMQLLDGKTVEVRPVFEILKSRLMADNTPEKAAKITGVTAKAITELAREFATAKPSMIICGGGTQHWYYSDVLLRAMHLLTALTGTEGTNGGGMNHYIGQWKPAFVAGLVALAFPEGVNKQRFCQTTIWTYIHAEVNDEIISSDIDTEKYLRDSITTGQMPNMPEQGRDPKVFFVYRGNWLNQAKGQKYVLENLWPKLELIVDINIRMDSTALYSDVVLPSAHWYEKLDLNVTSEHSYINMTEPAIKPMWESKTDWQIFLALAKRVEMAAKRKKYEKFNDEKFKWVRDLSNLWNQMTMDGKLAEDEAAAQYILDNAPQSKGITIQMLREKPQRFKSNWTSPLKEGVPYTPFQYFVVDKKPWPTLTGRQQFYLDHDTFFDMGVELPTYKAPIDADKYPFRFNSPHSRHSVHSTFKDNVLMLRLQRGGPSIEMSPLDAKPLGIKDNDWVEAWNNHGKVICRVKIRNGEQRGRVSMWHCPELYMDLLTGGSQSVCPVRINPTNLVGNYGHLFFRPNYYGPAGSQRDVRVNVKRYIGATPISF 899
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667       677       687       697       707       717       727       737       747       757       767       777       787       797       807       817       827       837       847       857       867       877       887       897  


Chain F from PDB  Type:PROTEIN  Length:328
                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeee.......hhhhhhhhhhhh...........eeeee.......hhhhh..eee..eee.....hhhhhh.....hhhhhhhh................................eeeee.......hhhhhhh....eee......eee........hhhhhhh.....eee....eee....hhhhhh....hhhhhh.....eeeee.....hhhhhhhh.....ee.hhhhh....eeee......eee.....eeeee..hhhhhhhhhh.hhhhhhhhhhhhhhhhhh...hhhhhhhhh.hhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5chc F   6 KAPRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPGLGYPRNWQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRVRPSPTPRSAPNWDEDQGAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAIYKREQDGIVVIHQDKCKGAQACVQSCPYAKPYFNPLTNKANKCIGCFPRIEQGVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQYKVALPLHPEFGTEPNVFYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAILQSEREKKMKGLASDLMDVLIGRRSTDMMISPLT 333
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5CHC)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5CHC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5CHC)

(-) Gene Ontology  (8, 9)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BSY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    F3S  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MD1  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MGD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SF4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
    AG5  [ RasMol ]  +environment [ RasMol ]
    AG6  [ RasMol ]  +environment [ RasMol ]
    AG7  [ RasMol ]  +environment [ RasMol ]
    AG8  [ RasMol ]  +environment [ RasMol ]
    AG9  [ RasMol ]  +environment [ RasMol ]
    AH1  [ RasMol ]  +environment [ RasMol ]
    AH2  [ RasMol ]  +environment [ RasMol ]
    AH3  [ RasMol ]  +environment [ RasMol ]
    AH4  [ RasMol ]  +environment [ RasMol ]
    AH5  [ RasMol ]  +environment [ RasMol ]
    AH6  [ RasMol ]  +environment [ RasMol ]
    AH7  [ RasMol ]  +environment [ RasMol ]
    AH8  [ RasMol ]  +environment [ RasMol ]
    AH9  [ RasMol ]  +environment [ RasMol ]
    AI1  [ RasMol ]  +environment [ RasMol ]
    AI2  [ RasMol ]  +environment [ RasMol ]
    AI3  [ RasMol ]  +environment [ RasMol ]
    AI4  [ RasMol ]  +environment [ RasMol ]
    AI5  [ RasMol ]  +environment [ RasMol ]
    AI6  [ RasMol ]  +environment [ RasMol ]
    AI7  [ RasMol ]  +environment [ RasMol ]
    AI8  [ RasMol ]  +environment [ RasMol ]
    AI9  [ RasMol ]  +environment [ RasMol ]
    AJ1  [ RasMol ]  +environment [ RasMol ]
    AJ2  [ RasMol ]  +environment [ RasMol ]
    AJ3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala B:52 - Pro B:53   [ RasMol ]  
    Ala D:52 - Pro D:53   [ RasMol ]  
    Ala F:52 - Pro F:53   [ RasMol ]  
    Asn A:70 - Pro A:71   [ RasMol ]  
    Asn C:70 - Pro C:71   [ RasMol ]  
    Asn E:70 - Pro E:71   [ RasMol ]  
    Asp C:366 - Gly C:367   [ RasMol ]  
    Lys A:414 - Pro A:415   [ RasMol ]  
    Lys C:414 - Pro C:415   [ RasMol ]  
    Lys E:414 - Pro E:415   [ RasMol ]  
    Met A:523 - Pro A:524   [ RasMol ]  
    Met C:523 - Pro C:524   [ RasMol ]  
    Met E:523 - Pro E:524   [ RasMol ]  
    Ser B:107 - Pro B:108   [ RasMol ]  
    Ser D:107 - Pro D:108   [ RasMol ]  
    Ser F:107 - Pro F:108   [ RasMol ]  
    Tyr B:125 - Pro B:126   [ RasMol ]  
    Tyr B:57 - Pro B:58   [ RasMol ]  
    Tyr D:125 - Pro D:126   [ RasMol ]  
    Tyr D:57 - Pro D:58   [ RasMol ]  
    Tyr F:125 - Pro F:126   [ RasMol ]  
    Tyr F:57 - Pro F:58   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5chc
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  G8QM54_DECSP | G8QM54
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  G8QM55_DECSP | G8QM55
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  G8QM54_DECSP | G8QM54
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  G8QM55_DECSP | G8QM55
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        G8QM54_DECSP | G8QM54: 4ydd 5ch7 5e7o
        G8QM55_DECSP | G8QM55: 4ydd 5ch7 5e7o

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5CHC)