5BXO - JenaLib

Molecule 1 - TANKYRASE-2
	Chains	:	A, B
	EC Number	:	2.4.2.30
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PGST
	Expression System Taxid	:	469008
	Expression System Variant	:	C41
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 488-649
	Gene	:	TNKS2, PARP5B, TANK2, TNKL
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TANK2,ADP-RIBOSYLTRANSFERASE DIPHTHERIA TOXIN-LIKE 6,ARTD6, POLY [ADP-RIBOSE] POLYMERASE 5B,TNKS-2,TRF1-INTERACTING ANKYRIN- RELATED ADP-RIBOSE POLYMERASE 2,TANKYRASE II,TANKYRASE-LIKE PROTEIN, TANKYRASE-RELATED PROTEIN

Molecule 2 - TANKYRASE-2
	Chains	:	C, D
	EC Number	:	2.4.2.30
	Engineered	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TANK2,ADP-RIBOSYLTRANSFERASE DIPHTHERIA TOXIN-LIKE 6,ARTD6, POLY [ADP-RIBOSE] POLYMERASE 5B,TNKS-2,TRF1-INTERACTING ANKYRIN- RELATED ADP-RIBOSE POLYMERASE 2,TANKYRASE II,TANKYRASE-LIKE PROTEIN, TANKYRASE-RELATED PROTEIN
	Synthetic	:	YES

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (5, 15)

Sites (19, 19)

Asymmetric Unit (19, 19)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ALA A:601 , LYS A:602 , LYS A:633 , HOH A:809 , ASN B:626 , HOH B:878	binding site for residue SO4 A 701
02	AC2	SOFTWARE	GLU A:576 , LYS A:580 , LYS A:592 , HIS A:614 , ARG A:623 , HOH A:869 , GLN B:613	binding site for residue SO4 A 702
03	AC3	SOFTWARE	ARG A:538 , VAL A:539 , SER A:540 , LYS A:557 , HOH A:805 , HOH A:825 , HOH A:856 , HOH A:868	binding site for residue SO4 A 703
04	AC4	SOFTWARE	CYS A:512 , HIS A:548 , HIS B:548	binding site for residue DMS A 704
05	AC5	SOFTWARE	LYS A:633 , ASP A:634 , HOH A:848 , GLY B:603 , LYS B:604 , TYR B:605 , GLU B:606 , HOH B:811 , HOH B:815 , HOH B:861	binding site for residue SO4 B 701
06	AC6	SOFTWARE	LYS B:592 , GLN B:613 , HIS B:614 , ARG B:623 , HOH B:806	binding site for residue SO4 B 702
07	AC7	SOFTWARE	ASN B:537 , ARG B:538 , VAL B:539 , SER B:540 , LYS B:557 , HOH B:802 , HOH B:825	binding site for residue SO4 B 703
08	AC8	SOFTWARE	TYR B:605 , LYS B:609 , ASP B:624 , GLY B:625 , HOH B:827	binding site for residue DMS B 704
09	AC9	SOFTWARE	LYS B:555 , ASP B:556 , GLY B:559	binding site for residue DMS B 705
10	AD1	SOFTWARE	ASP A:589 , TRP A:591 , PHE A:593 , GLU A:598 , HOH A:879 , ASP B:634 , THR B:637 , GLU C:2 , HOH C:207	binding site for Di-peptide ACE C 0 and ARG C 1
11	AD2	SOFTWARE	TYR A:569 , HIS A:571 , LYS A:602 , HOH A:837 , GLU B:491 , ARG B:494 , ALA C:7 , 4XP C:100 , HOH C:204 , HOH C:206	binding site for Di-peptide GLU C 8 and NH2 C 9
12	AD3	SOFTWARE	TYR A:569 , HIS A:571 , LYS A:602 , HOH A:837 , GLU B:491 , ARG B:494 , ALA C:7 , 4XP C:100 , HOH C:204 , HOH C:206	binding site for Di-peptide GLU C 8 and NH2 C 9
13	AD4	SOFTWARE	ARG A:525 , TYR A:569 , GLU B:506 , THR B:507 , GLU B:523 , GLU C:2 , GLY C:4 , GLY C:6 , ALA C:7 , GLU C:8 , NH2 C:9 , HOH C:202 , HOH C:203	binding site for Di-peptide 4XP C 100 and ALA C 3
14	AD5	SOFTWARE	GLY A:535 , TYR A:569 , HIS A:571 , GLU B:506 , THR B:507 , GLU B:523 , ALA C:3 , GLY C:6 , GLU C:8 , NH2 C:9 , HOH C:203 , HOH C:209	binding site for Di-peptide 4XP C 100 and ALA C 7
15	AD6	SOFTWARE	ASP A:634 , GLY A:635 , THR A:637 , ASP B:589 , TRP B:591 , PHE B:593 , GLU B:598 , GLU D:2 , HOH D:208	binding site for Di-peptide ACE D 0 and ARG D 1
16	AD7	SOFTWARE	ARG A:494 , TYR B:569 , HIS B:571 , LYS B:602 , HOH B:829 , ALA D:7 , 4XP D:100 , HOH D:201 , HOH D:210 , HOH D:212	binding site for Di-peptide GLU D 8 and NH2 D 9
17	AD8	SOFTWARE	ARG A:494 , TYR B:569 , HIS B:571 , LYS B:602 , HOH B:829 , ALA D:7 , 4XP D:100 , HOH D:201 , HOH D:210 , HOH D:212	binding site for Di-peptide GLU D 8 and NH2 D 9
18	AD9	SOFTWARE	ARG A:494 , GLU A:506 , GLU A:523 , GLY B:535 , TYR B:569 , HIS B:571 , ALA D:3 , GLY D:6 , GLU D:8 , NH2 D:9 , HOH D:205 , HOH D:209	binding site for Di-peptide 4XP D 100 and ALA D 7
19	AE1	SOFTWARE	ARG A:494 , GLU A:506 , GLU A:523 , ARG B:525 , TYR B:569 , GLU D:2 , GLY D:4 , GLY D:6 , ALA D:7 , GLU D:8 , HOH D:203 , HOH D:205 , HOH D:215	binding site for Di-peptide 4XP D 100 and ALA D 3

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:160
                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhh............hhhhhh...hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5bxo A 487 SGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGD 646
                                   496       506       516       526       536       546       556       566       576       586       596       606       616       626       636       646

Chain B from PDB  Type:PROTEIN  Length:163
                                                                                                                                                                                                   
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhh............hhhhhh...hhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5bxo B 487 SGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAAL 649
                                   496       506       516       526       536       546       556       566       576       586       596       606       616       626       636       646

Chain C from PDB  Type:PROTEIN  Length:10
                                          
               SCOP domains ---------- SCOP domains
               CATH domains ---------- CATH domains
               Pfam domains ---------- Pfam domains
         Sec.struct. author .......... Sec.struct. author
                 SAPs(SNPs) ---------- SAPs(SNPs)
                    PROSITE ---------- PROSITE
                 Transcript ---------- Transcript
                 5bxo C   0 xREAGDGAEx   9
                            |        9
                            0-ACE    9-NH2

Chain D from PDB  Type:PROTEIN  Length:10
                                          
               SCOP domains ---------- SCOP domains
               CATH domains ---------- CATH domains
               Pfam domains ---------- Pfam domains
         Sec.struct. author .......... Sec.struct. author
                 SAPs(SNPs) ---------- SAPs(SNPs)
                    PROSITE ---------- PROSITE
                 Transcript ---------- Transcript
                 5bxo D   0 xREAGDGAEx   9
                            |        9
                            |        9-NH2
                            0-ACE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (29, 29)

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		4XP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ACE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		DMS	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NH2	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		AD5	[ RasMol ]	+environment [ RasMol ]
		AD6	[ RasMol ]	+environment [ RasMol ]
		AD7	[ RasMol ]	+environment [ RasMol ]
		AD8	[ RasMol ]	+environment [ RasMol ]
		AD9	[ RasMol ]	+environment [ RasMol ]
		AE1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ser B:487 - Gly B:488	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	5bxo
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	TNKS2_HUMAN \| Q9H2K2
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.4.2.30
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds