Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF RHESUS MACAQUE MHC CLASS I MOLECULE MAMU-B*098 COMPLEXED WITH MYRISTOYLATED 5-MER LIPOPEPTIDE DERIVED FROM SIV NEF PROTEIN
 
Authors :  D. Morita, M. Sugita
Date :  22 Apr 15  (Deposition) - 13 Jan 16  (Release) - 27 Jan 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.76
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L
Biol. Unit 1:  A,B,C  (1x)
Biol. Unit 2:  D,E,F  (1x)
Biol. Unit 3:  G,H,I  (1x)
Biol. Unit 4:  J,K,L  (1x)
Keywords :  Mhc, Lipopeptide, Antigen Presentation, Aids, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Morita, Y. Yamamoto, T. Mizutani, T. Ishikawa, J. Suzuki, T. Igarashi, N. Mori, T. Shiina, H. Inoko, H. Fujita, K. Iwai, Y. Tanaka B. Mikami, M. Sugita
Crystal Structure Of The N-Myristoylated Lipopeptide-Bound Mhc Class I Complex
Nat Commun V. 7 10356 2016
PubMed-ID: 26758274  |  Reference-DOI: 10.1038/NCOMMS10356

(-) Compounds

Molecule 1 - MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I
    Chains: A, D, G, J
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Common: RHESUS MACAQUE
    Organism Scientific: MACACA MULATTA
    Organism Taxid: 9544
 
Molecule 2 - BETA-2-MICROGLOBULIN
    Chains: B, E, H, K
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: B2M
    Organism Common: RHESUS MACAQUE
    Organism Scientific: MACACA MULATTA
    Organism Taxid: 9544
 
Molecule 3 - 5-MER LIPOPEPTIDE FROM PROTEIN NEF
    Chains: C, F, I, L
    Engineered: YES
    Organism Common: SIV-SM
    Organism Scientific: SIMIAN IMMUNODEFICIENCY VIRUS
    Organism Taxid: 11737
    Synthetic: YES

 Structural Features

(-) Chains, Units

  123456789101112
Asymmetric Unit : ABCDEFGHIJKL
Biological Unit 1 (1x): ABC         
Biological Unit 2 (1x):    DEF      
Biological Unit 3 (1x):       GHI   
Biological Unit 4 (1x):          JKL

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 92)

Asymmetric Unit (5, 92)
No.NameCountTypeFull Name
1CL3Ligand/IonCHLORIDE ION
2EDO65Ligand/Ion1,2-ETHANEDIOL
3MYR4Ligand/IonMYRISTIC ACID
4TRS2Ligand/Ion2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
5ZN18Ligand/IonZINC ION
Biological Unit 1 (3, 18)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2EDO16Ligand/Ion1,2-ETHANEDIOL
3MYR1Ligand/IonMYRISTIC ACID
4TRS1Ligand/Ion2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
5ZN-1Ligand/IonZINC ION
Biological Unit 2 (3, 17)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2EDO15Ligand/Ion1,2-ETHANEDIOL
3MYR1Ligand/IonMYRISTIC ACID
4TRS1Ligand/Ion2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
5ZN-1Ligand/IonZINC ION
Biological Unit 3 (2, 17)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2EDO16Ligand/Ion1,2-ETHANEDIOL
3MYR1Ligand/IonMYRISTIC ACID
4TRS-1Ligand/Ion2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
5ZN-1Ligand/IonZINC ION
Biological Unit 4 (2, 19)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2EDO18Ligand/Ion1,2-ETHANEDIOL
3MYR1Ligand/IonMYRISTIC ACID
4TRS-1Ligand/Ion2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
5ZN-1Ligand/IonZINC ION

(-) Sites  (92, 92)

Asymmetric Unit (92, 92)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:191 , ALA A:199 , GLU A:254 , GLU G:58 , GLU G:61binding site for residue ZN A 301
02AC2SOFTWAREGLU A:58 , GLU A:61 , HIS G:191 , ALA G:199 , GLU G:254binding site for residue ZN A 302
03AC3SOFTWAREHIS A:192 , ASP B:98 , HOH B:253binding site for residue ZN A 303
04AC4SOFTWAREALA A:0 , HIS A:3 , GLN A:180 , GLU J:138binding site for residue ZN A 304
05AC5SOFTWAREALA A:0 , HIS A:3 , LEU A:179 , GLN A:180 , GLU A:264 , TRS A:314 , HOH A:409binding site for residue EDO A 305
06AC6SOFTWAREGLY A:1 , GLY A:104 , PRO A:105 , HOH A:472 , ASP J:137 , GLU J:138binding site for residue EDO A 306
07AC7SOFTWARETYR A:7 , GLN A:63 , TYR A:159 , GLU A:163 , SER A:167 , TYR A:171 , MYR C:101binding site for residue EDO A 307
08AC8SOFTWAREPHE A:8 , ASP A:30 , HOH A:479binding site for residue EDO A 308
09AC9SOFTWAREARG A:35 , GLU A:46 , PRO A:47 , ARG A:48binding site for residue EDO A 309
10AD1SOFTWAREARG A:108 , LEU A:109 , GLU A:161 , LEU A:165 , HOH A:502binding site for residue EDO A 310
11AD2SOFTWAREGLY A:237 , HOH A:403 , HOH A:461 , SER B:52binding site for residue EDO A 311
12AD3SOFTWAREARG A:6 , MET A:98 , TYR A:113 , EDO B:103binding site for residue EDO A 312
13AD4SOFTWAREPRO A:15 , GLY A:16 , ARG A:17 , GLY A:18binding site for residue EDO A 313
14AD5SOFTWAREALA A:0 , SER A:2 , HIS A:3 , SER A:4 , ASP A:29 , PRO A:210 , GLU A:264 , EDO A:305 , HOH A:456 , HOH A:467binding site for residue TRS A 314
15AD6SOFTWAREARG A:75binding site for residue CL A 315
16AD7SOFTWAREHIS B:51 , EDO B:109 , HOH B:257binding site for residue ZN B 101
17AD8SOFTWAREGLU B:36 , EDO B:108 , HOH B:211 , HIS D:197binding site for residue ZN B 102
18AD9SOFTWAREPHE A:8 , MET A:98 , EDO A:312 , SER B:57 , LYS B:58 , TRP B:60 , HOH B:216binding site for residue EDO B 103
19AE1SOFTWAREARG A:21 , ILE A:23 , SER B:33 , ASP B:34 , HOH B:202binding site for residue EDO B 104
20AE2SOFTWAREGLN B:8 , VAL B:9 , LYS B:94 , ASP B:96 , HOH B:242binding site for residue EDO B 105
21AE3SOFTWARETRP A:204 , MET B:99 , EDO B:107binding site for residue EDO B 106
22AE4SOFTWARETRP A:204 , LEU A:206 , ARG A:234 , GLN A:242 , TYR B:10 , SER B:11 , HIS B:13 , PRO B:14 , EDO B:106binding site for residue EDO B 107
23AE5SOFTWAREGLU B:36 , ZN B:102 , ASP D:196 , HIS D:197 , GLN J:54binding site for residue EDO B 108
24AE6SOFTWAREARG A:21 , HIS B:51 , ZN B:101 , HOH B:234binding site for residue EDO B 109
25AE7SOFTWAREGLN A:63 , ARG A:66 , ALA A:70 , PHE A:74 , TYR A:114 , TYR A:159 , EDO A:307 , HOH A:417 , HOH A:438 , GLY C:2binding site for residue MYR C 101
26AE8SOFTWAREHIS D:191 , ALA D:199 , GLU D:254 , GLU J:58 , GLU J:61binding site for residue ZN D 301
27AE9SOFTWAREHIS D:192 , ASP E:98 , HOH E:255binding site for residue ZN D 302
28AF1SOFTWAREALA D:0 , HIS D:3 , GLN D:180 , GLU G:138binding site for residue ZN D 303
29AF2SOFTWAREALA D:0 , LEU D:179 , GLN D:180 , GLU D:264 , TRS D:312 , HOH D:413binding site for residue EDO D 304
30AF3SOFTWARETYR D:27 , ASP D:29 , ASP D:30 , HOH D:464binding site for residue EDO D 305
31AF4SOFTWARETYR D:7 , GLN D:63 , TYR D:159 , GLU D:163 , SER D:167 , TYR D:171 , MYR F:101binding site for residue EDO D 306
32AF5SOFTWAREGLY D:237 , EDO D:309 , HOH D:460 , SER E:52binding site for residue EDO D 307
33AF6SOFTWAREHOH D:405 , ASP J:196binding site for residue EDO D 308
34AF7SOFTWARETYR D:27 , PRO D:235 , EDO D:307 , SER E:52 , TYR E:63 , HOH E:212binding site for residue EDO D 309
35AF8SOFTWAREPRO D:47 , ARG D:48binding site for residue EDO D 310
36AF9SOFTWAREARG D:6 , TYR D:113 , EDO E:103binding site for residue EDO D 311
37AG1SOFTWAREALA D:0 , SER D:2 , HIS D:3 , SER D:4 , ASP D:29 , PRO D:210 , GLU D:264 , EDO D:304 , HOH D:415 , HOH D:469 , HOH D:511binding site for residue TRS D 312
38AG2SOFTWAREHIS E:51 , EDO E:108 , HOH E:256binding site for residue ZN E 101
39AG3SOFTWAREHIS A:197 , GLU E:36 , EDO E:109 , HOH E:202 , HOH E:222binding site for residue ZN E 102
40AG4SOFTWAREEDO D:311 , SER E:57 , LYS E:58 , TRP E:60 , HOH E:231binding site for residue EDO E 103
41AG5SOFTWARETRP D:204 , LEU D:206 , ARG D:234 , GLN D:242 , TYR E:10 , SER E:11 , HIS E:13 , PRO E:14 , EDO E:105binding site for residue EDO E 104
42AG6SOFTWAREMET E:99 , EDO E:104binding site for residue EDO E 105
43AG7SOFTWAREARG D:21 , SER E:33 , ASP E:34 , EDO E:107binding site for residue EDO E 106
44AG8SOFTWAREILE D:23 , HIS E:51 , SER E:52 , ASP E:53 , LEU E:54 , EDO E:106 , EDO E:108binding site for residue EDO E 107
45AG9SOFTWAREARG D:21 , HIS E:51 , ZN E:101 , EDO E:107 , HOH E:241binding site for residue EDO E 108
46AH1SOFTWAREHIS A:197 , GLU E:36 , ZN E:102 , HOH E:222 , GLN G:54 , GLU G:55 , GLY G:56binding site for residue EDO E 109
47AH2SOFTWAREHIS G:192 , ASP H:98binding site for residue ZN G 301
48AH3SOFTWAREGLU D:138 , ALA G:0 , HIS G:3 , EDO G:311 , HOH G:409binding site for residue ZN G 302
49AH4SOFTWARETYR G:7 , GLN G:63 , TYR G:159 , SER G:167 , TYR G:171 , HOH G:428binding site for residue EDO G 303
50AH5SOFTWAREASP G:122 , TYR G:123 , ILE G:124 , ALA G:125 , THR G:134 , ALA G:136 , HOH G:416 , HOH G:431 , HOH G:479binding site for residue EDO G 304
51AH6SOFTWAREPHE G:8 , TYR G:27 , ASP G:29 , ASP G:30 , HOH H:810binding site for residue EDO G 305
52AH7SOFTWAREGLY D:1 , GLY D:104 , PRO D:105 , ASP G:137 , GLU G:138 , HOH G:444 , HOH G:459binding site for residue EDO G 306
53AH8SOFTWARETHR G:178 , ARG G:181 , GLU G:183 , GLY G:239 , HOH G:417binding site for residue EDO G 307
54AH9SOFTWAREGLY G:207 , ASP G:238 , THR G:240 , GLN G:242 , HOH G:424 , ARG H:12binding site for residue EDO G 308
55AI1SOFTWAREALA G:0 , HIS G:3 , ASP G:29 , LEU G:179 , ARG G:181 , GLU G:264 , HOH G:409binding site for residue EDO G 309
56AI2SOFTWAREGLU G:212 , THR G:214 , GLN G:262 , HIS G:263 , GLU G:264binding site for residue EDO G 310
57AI3SOFTWAREGLU D:138 , ALA G:0 , HIS G:3 , GLN G:180 , ZN G:302 , HOH G:409binding site for residue EDO G 311
58AI4SOFTWARETYR G:85 , ARG G:121 , ASP G:122 , ASP G:137 , HOH G:430binding site for residue EDO G 312
59AI5SOFTWAREASP D:106 , GLN G:87 , TYR G:118 , ASP G:119binding site for residue EDO G 313
60AI6SOFTWAREARG G:75binding site for residue CL G 314
61AI7SOFTWAREHIS H:51 , EDO H:106 , HOH H:836 , HOH H:840binding site for residue ZN H 101
62AI8SOFTWAREPHE G:8 , MET G:98 , SER H:57 , LYS H:58 , TRP H:60 , HOH H:811binding site for residue EDO H 102
63AI9SOFTWAREARG G:21 , SER H:33 , ASP H:34binding site for residue EDO H 103
64AJ1SOFTWAREARG G:234 , GLN G:242 , TYR H:10 , SER H:11 , HIS H:13 , PRO H:14 , MET H:99binding site for residue EDO H 104
65AJ2SOFTWAREGLU H:36 , ASP H:38 , ARG H:81 , ASN H:83 , PRO H:90 , HOH H:809binding site for residue EDO H 105
66AJ3SOFTWAREHIS H:51 , ZN H:101binding site for residue EDO H 106
67AJ4SOFTWAREGLU D:58 , GLU D:61 , HIS J:191 , ALA J:199 , GLU J:254binding site for residue ZN J 301
68AJ5SOFTWAREGLU A:138 , HOH A:401 , ALA J:0 , HIS J:3 , EDO J:314binding site for residue ZN J 302
69AJ6SOFTWARETYR J:27 , ASP J:29 , ASP J:30 , HOH K:213binding site for residue EDO J 303
70AJ7SOFTWAREASP J:122 , TYR J:123 , ILE J:124 , ALA J:125 , THR J:134 , ALA J:136 , HOH J:414 , HOH J:454binding site for residue EDO J 304
71AJ8SOFTWAREGLY J:207 , ASP J:238 , THR J:240 , GLN J:242 , HOH J:456 , ARG K:12binding site for residue EDO J 305
72AJ9SOFTWARETRP J:204 , ARG J:234 , TRP J:244 , HOH J:448 , VAL K:9 , TYR K:10 , ASP K:96 , EDO K:107binding site for residue EDO J 306
73AK1SOFTWAREASP A:106 , GLN J:87 , TYR J:118 , ASP J:119 , ARG J:121 , HOH J:426 , HOH J:468binding site for residue EDO J 307
74AK2SOFTWARETYR J:7 , TYR J:159 , SER J:167 , TYR J:171 , HOH J:441binding site for residue EDO J 308
75AK3SOFTWAREALA J:0 , SER J:2 , ASP J:29 , GLU J:264 , EDO J:310 , HOH J:432binding site for residue EDO J 309
76AK4SOFTWAREHOH A:401 , ALA J:0 , HIS J:3 , ASP J:29 , LEU J:179 , ARG J:181 , GLU J:264 , EDO J:309binding site for residue EDO J 310
77AK5SOFTWAREALA J:136 , ASP J:137 , HOH J:415 , HOH J:435binding site for residue EDO J 311
78AK6SOFTWAREARG J:48 , HOH J:520binding site for residue EDO J 312
79AK7SOFTWAREGLN J:115 , ASP J:122 , LYS K:58binding site for residue EDO J 313
80AK8SOFTWAREGLU A:138 , HOH A:401 , ALA J:0 , HIS J:3 , GLN J:180 , ZN J:302binding site for residue EDO J 314
81AK9SOFTWAREARG J:75binding site for residue CL J 315
82AL1SOFTWAREHIS J:192 , HOH J:534 , ASP K:98binding site for residue ZN K 101
83AL2SOFTWAREHIS K:51 , EDO K:108 , HOH K:234 , HOH K:238binding site for residue ZN K 102
84AL3SOFTWAREMET J:98 , SER K:57 , LYS K:58 , TRP K:60 , HOH K:214binding site for residue EDO K 103
85AL4SOFTWAREARG J:234 , GLN J:242 , TYR K:10 , SER K:11 , HIS K:13 , PRO K:14 , MET K:99 , HOH K:221binding site for residue EDO K 104
86AL5SOFTWAREARG J:21 , SER K:33 , ASP K:34binding site for residue EDO K 105
87AL6SOFTWAREGLU K:36 , ASP K:38 , ARG K:81 , ASN K:83 , PRO K:90binding site for residue EDO K 106
88AL7SOFTWAREARG J:202 , TRP J:204 , EDO J:306 , ASP K:96 , ASP K:98 , MET K:99binding site for residue EDO K 107
89AL8SOFTWAREHIS K:51 , ZN K:102binding site for residue EDO K 108
90AL9SOFTWAREGLN D:63 , ARG D:66 , VAL D:67 , ASP D:69 , ALA D:70 , THR D:73 , PHE D:74 , TYR D:114 , TRP D:156 , TYR D:159 , EDO D:306 , HOH D:410 , GLY F:3 , ALA F:4binding site for Di-peptide MYR F 101 and GLY F 2
91AM1SOFTWAREASP G:69 , THR G:73 , GLN G:155 , TRP G:156 , GLY I:3 , ALA I:4binding site for Di-peptide MYR I 101 and GLY I 2
92AM2SOFTWAREASP J:69 , THR J:73 , GLY L:3 , ALA L:4binding site for Di-peptide MYR L 101 and GLY L 2

(-) SS Bonds  (12, 12)

Asymmetric Unit
No.Residues
1A:101 -A:164
2A:203 -A:259
3B:25 -B:80
4D:101 -D:164
5D:203 -D:259
6E:25 -E:80
7G:101 -G:164
8G:203 -G:259
9H:25 -H:80
10J:101 -J:164
11J:203 -J:259
12K:25 -K:80

(-) Cis Peptide Bonds  (8, 8)

Asymmetric Unit
No.Residues
1Tyr A:209 -Pro A:210
2His B:31 -Pro B:32
3Tyr D:209 -Pro D:210
4His E:31 -Pro E:32
5Tyr G:209 -Pro G:210
6His H:31 -Pro H:32
7Tyr J:209 -Pro J:210
8His K:31 -Pro K:32

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ZFZ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ZFZ)

(-) Exons   (0, 0)

(no "Exon" information available for 4ZFZ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:277
                                                                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeee........eeeeeeee..eeeeeee........ee.hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........eeeeeeeeee.....eeeeeeeeee..eeeeee......eee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeeee....eeeeeeeeeee.....eeeeee..ee.hhhhee...ee.....eeeeeeeeee.hhhh.eeeeee.......eee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zfz A   0 AGSHSMRYFSTTVSRPGRGEPRFIVVGYVDDTQFVRFDSDAASPKMEPRAPWMEQEGPEYWEEQTRRVKDAAQTFRVSLGNLRGYYNQSEAGSHTLQTMSGCDLGPDGRLLRGYYQQAYDGRDYIALNEDLRSWTAADEAAQNTQRKWEAAGVAEQWRAYLEGECLESLRRYLENGKETLQRAEPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP 276
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       


Chain B from PDB  Type:PROTEIN  Length:100
                                                                                                                                    
               SCOP domains ---------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeee.........eeeeeeeeee.....eeeeee..ee....ee...ee.....eeeeeeeee.......eeeeee.......eeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------- Transcript
                 4zfz B   0 AIQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM  99
                                     9        19        29        39        49        59        69        79        89        99


Chain C from PDB  Type:PROTEIN  Length:5
                                     
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..... Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 4zfz C   2 GGAIS   6


Chain D from PDB  Type:PROTEIN  Length:277
                                                                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeee........eeeeeeee..eeeeeee........ee.hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........eeeeeeeeee.....eeeeeeeeee..eeeeee......eee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeeee....eeeeeeeeeee.....eeeeee..ee.hhhhee...ee.....eeeeeeeeee.hhhh.eeeeee.......eee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zfz D   0 AGSHSMRYFSTTVSRPGRGEPRFIVVGYVDDTQFVRFDSDAASPKMEPRAPWMEQEGPEYWEEQTRRVKDAAQTFRVSLGNLRGYYNQSEAGSHTLQTMSGCDLGPDGRLLRGYYQQAYDGRDYIALNEDLRSWTAADEAAQNTQRKWEAAGVAEQWRAYLEGECLESLRRYLENGKETLQRAEPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP 276
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       


Chain E from PDB  Type:PROTEIN  Length:100
                                                                                                                                    
               SCOP domains ---------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeee.........eeeeeeeeee.....eeeeee..ee....ee...ee.....eeeeeeeee.......eeeeee.......eeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------- Transcript
                 4zfz E   0 AIQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM  99
                                     9        19        29        39        49        59        69        79        89        99


Chain F from PDB  Type:PROTEIN  Length:5
                                     
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..... Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 4zfz F   2 GGAIS   6


Chain G from PDB  Type:PROTEIN  Length:277
                                                                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeee........eeeeeeee..eeeeeee........ee.hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........eeeeeeeeee.....eeeeeeeeee..eeeeee......eee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeeee....eeeeeeeeeee.....eeeeee..ee.hhhhee...ee.....eeeeeeeeee.hhhh.eeeeee.......eee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zfz G   0 AGSHSMRYFSTTVSRPGRGEPRFIVVGYVDDTQFVRFDSDAASPKMEPRAPWMEQEGPEYWEEQTRRVKDAAQTFRVSLGNLRGYYNQSEAGSHTLQTMSGCDLGPDGRLLRGYYQQAYDGRDYIALNEDLRSWTAADEAAQNTQRKWEAAGVAEQWRAYLEGECLESLRRYLENGKETLQRAEPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP 276
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       


Chain H from PDB  Type:PROTEIN  Length:100
                                                                                                                                    
               SCOP domains ---------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeee.........eeeeeeeeee.....eeeeee..ee....ee...ee.....eeeeeeeee.......eeeeee.......eeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------- Transcript
                 4zfz H   0 AIQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM  99
                                     9        19        29        39        49        59        69        79        89        99


Chain I from PDB  Type:PROTEIN  Length:5
                                     
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..... Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 4zfz I   2 GGAIS   6


Chain J from PDB  Type:PROTEIN  Length:277
                                                                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeee........eeeeeeee..eeeeeee........ee.hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........eeeeeeeeee.....eeeeeeeeee..eeeeee......eee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeeee....eeeeeeeeeee.....eeeeee..ee.hhhhee...ee.....eeeeeeeeee.hhhh.eeeeee.......eee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zfz J   0 AGSHSMRYFSTTVSRPGRGEPRFIVVGYVDDTQFVRFDSDAASPKMEPRAPWMEQEGPEYWEEQTRRVKDAAQTFRVSLGNLRGYYNQSEAGSHTLQTMSGCDLGPDGRLLRGYYQQAYDGRDYIALNEDLRSWTAADEAAQNTQRKWEAAGVAEQWRAYLEGECLESLRRYLENGKETLQRAEPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP 276
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       


Chain K from PDB  Type:PROTEIN  Length:100
                                                                                                                                    
               SCOP domains ---------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeee.........eeeeeeeeee.....eeeeee..ee....ee...ee.....eeeeeeeee.......eeeeee.......eeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------- Transcript
                 4zfz K   0 AIQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM  99
                                     9        19        29        39        49        59        69        79        89        99


Chain L from PDB  Type:PROTEIN  Length:5
                                     
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..... Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 4zfz L   2 GGAIS   6
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4ZFZ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ZFZ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ZFZ)

(-) Gene Ontology  (15, 20)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MYR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TRS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
    AG5  [ RasMol ]  +environment [ RasMol ]
    AG6  [ RasMol ]  +environment [ RasMol ]
    AG7  [ RasMol ]  +environment [ RasMol ]
    AG8  [ RasMol ]  +environment [ RasMol ]
    AG9  [ RasMol ]  +environment [ RasMol ]
    AH1  [ RasMol ]  +environment [ RasMol ]
    AH2  [ RasMol ]  +environment [ RasMol ]
    AH3  [ RasMol ]  +environment [ RasMol ]
    AH4  [ RasMol ]  +environment [ RasMol ]
    AH5  [ RasMol ]  +environment [ RasMol ]
    AH6  [ RasMol ]  +environment [ RasMol ]
    AH7  [ RasMol ]  +environment [ RasMol ]
    AH8  [ RasMol ]  +environment [ RasMol ]
    AH9  [ RasMol ]  +environment [ RasMol ]
    AI1  [ RasMol ]  +environment [ RasMol ]
    AI2  [ RasMol ]  +environment [ RasMol ]
    AI3  [ RasMol ]  +environment [ RasMol ]
    AI4  [ RasMol ]  +environment [ RasMol ]
    AI5  [ RasMol ]  +environment [ RasMol ]
    AI6  [ RasMol ]  +environment [ RasMol ]
    AI7  [ RasMol ]  +environment [ RasMol ]
    AI8  [ RasMol ]  +environment [ RasMol ]
    AI9  [ RasMol ]  +environment [ RasMol ]
    AJ1  [ RasMol ]  +environment [ RasMol ]
    AJ2  [ RasMol ]  +environment [ RasMol ]
    AJ3  [ RasMol ]  +environment [ RasMol ]
    AJ4  [ RasMol ]  +environment [ RasMol ]
    AJ5  [ RasMol ]  +environment [ RasMol ]
    AJ6  [ RasMol ]  +environment [ RasMol ]
    AJ7  [ RasMol ]  +environment [ RasMol ]
    AJ8  [ RasMol ]  +environment [ RasMol ]
    AJ9  [ RasMol ]  +environment [ RasMol ]
    AK1  [ RasMol ]  +environment [ RasMol ]
    AK2  [ RasMol ]  +environment [ RasMol ]
    AK3  [ RasMol ]  +environment [ RasMol ]
    AK4  [ RasMol ]  +environment [ RasMol ]
    AK5  [ RasMol ]  +environment [ RasMol ]
    AK6  [ RasMol ]  +environment [ RasMol ]
    AK7  [ RasMol ]  +environment [ RasMol ]
    AK8  [ RasMol ]  +environment [ RasMol ]
    AK9  [ RasMol ]  +environment [ RasMol ]
    AL1  [ RasMol ]  +environment [ RasMol ]
    AL2  [ RasMol ]  +environment [ RasMol ]
    AL3  [ RasMol ]  +environment [ RasMol ]
    AL4  [ RasMol ]  +environment [ RasMol ]
    AL5  [ RasMol ]  +environment [ RasMol ]
    AL6  [ RasMol ]  +environment [ RasMol ]
    AL7  [ RasMol ]  +environment [ RasMol ]
    AL8  [ RasMol ]  +environment [ RasMol ]
    AL9  [ RasMol ]  +environment [ RasMol ]
    AM1  [ RasMol ]  +environment [ RasMol ]
    AM2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    His B:31 - Pro B:32   [ RasMol ]  
    His E:31 - Pro E:32   [ RasMol ]  
    His H:31 - Pro H:32   [ RasMol ]  
    His K:31 - Pro K:32   [ RasMol ]  
    Tyr A:209 - Pro A:210   [ RasMol ]  
    Tyr D:209 - Pro D:210   [ RasMol ]  
    Tyr G:209 - Pro G:210   [ RasMol ]  
    Tyr J:209 - Pro J:210   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4zfz
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B2MG_MACMU | Q6V7J5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  K4MU32_MACMU | K4MU32
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  NEF_SIVS4 | P12482
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  B2MG_MACMU | Q6V7J5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  K4MU32_MACMU | K4MU32
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  NEF_SIVS4 | P12482
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        B2MG_MACMU | Q6V7J5: 3jtt 3rwc 3rwd 3rwe 3rwf 3rwg 3rwh 3rwi

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4ZFZ)