Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF VH1-46 GERMLINE-DERIVED CD4-BINDING SITE-DIRECTED ANTIBODY 1B2530 IN COMPLEX WITH HIV-1 CLADE A/E 93TH057 GP120
 
Authors :  P. Acharya, T. Zhou, S. Moquin, P. D. Kwong
Date :  25 Feb 15  (Deposition) - 03 Jun 15  (Release) - 17 Jun 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.39
Chains :  Asym. Unit :  E,F,G,H,I,L
Biol. Unit 1:  G,H,L  (1x)
Biol. Unit 2:  E,F,I  (1x)
Keywords :  Hiv-1 Cd4 Binding Site, Broadly Neutralizing Antibody, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Zhou, R. M. Lynch, L. Chen, P. Acharya, X. Wu, N. A. Doria-Rose, M. G. Joyce, D. Lingwood, C. Soto, R. T. Bailer, M. J. Ernandes, R. Kong, N. S. Longo, M. K. Louder, K. Mckee, S. O'Dell, S. D. Schmidt, L. Tran, Z. Yang, A. Druz, T. S. Luongo, S. Moquin, S. Srivatsan, Y. Yang, B. Zhang, A. Zheng, M. Pancera, T. Kirys, I. S. Georgiev, T. Gindin, H. P. Peng, A. S. Yang, J. C. Mullikin, M. D. Gray, L. Stamatatos, D. R. Burton, W. C. Koff, M. S. Cohen, B. F. Haynes, J. P. Casazza, M. Connors, D. Corti, A. Lanzavecchia, Q. J. Sattentau, R. A. Weiss, A. P. West, P. J. Bjorkman, J. F. Scheid, M. C. Nussenzweig, L. Shapiro, J. R. Mascola, P. D. Kwong
Structural Repertoire Of Hiv-1-Neutralizing Antibodies Targeting The Cd4 Supersite In 14 Donors.
Cell V. 161 1280 2015
PubMed-ID: 26004070  |  Reference-DOI: 10.1016/J.CELL.2015.05.007

(-) Compounds

Molecule 1 - ENVELOPE GLYCOPROTEIN GP160,ENVELOPE GLYCOPROTEIN GP160, ENVELOPE GLYCOPROTEIN GP160
    Chains: G, E
    Engineered: YES
    Expression System: HOMO SAPIENS
    Expression System Cell Line: 293F
    Expression System Common: HUMAN
    Expression System Plasmid: PVRC8400
    Expression System Taxid: 9606
    Fragment: UNP RESIDUES 43-122, 201-303, 325-486,UNP RESIDUES 43-122, 201-303, 325-486,UNP RESIDUES 43-122, 201-303, 325-486
    Gene: ENV
    Organism Scientific: HUMAN IMMUNODEFICIENCY VIRUS 1
    Organism Taxid: 11676
    Variant: DELTA V1V2V3
 
Molecule 2 - 1B2530 HEAVY CHAIN
    Chains: H, F
    Engineered: YES
    Expression System: HOMO SAPIENS
    Expression System Common: HUMAN
    Expression System Plasmid: PVRC8400
    Expression System Taxid: 9606
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
 
Molecule 3 - 1B2530 LIGHT CHAIN
    Chains: L, I
    Engineered: YES
    Expression System: HOMO SAPIENS
    Expression System Common: HUMAN
    Expression System Taxid: 9606
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : EFGHIL
Biological Unit 1 (1x):   GH L
Biological Unit 2 (1x): EF  I 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 16)

Asymmetric Unit (1, 16)
No.NameCountTypeFull Name
1NAG16Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 1 (1, 6)
No.NameCountTypeFull Name
1NAG6Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 2 (1, 10)
No.NameCountTypeFull Name
1NAG10Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (16, 16)

Asymmetric Unit (16, 16)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASN E:88 , SER F:115 , SER F:173binding site for residue NAG E 501
02AC2SOFTWAREASN E:234 , THR E:236 , SER E:274binding site for Mono-Saccharide NAG E 502 bound to ASN E 234
03AC3SOFTWAREASN E:229 , ASN E:241binding site for Mono-Saccharide NAG E 503 bound to ASN E 241
04AC4SOFTWAREASN E:276 , THR E:278 , ILE F:100F , TYR I:32 , TYR I:91 , SER I:93 , ASP I:94binding site for Mono-Saccharide NAG E 504 bound to ASN E 276
05AC5SOFTWAREGLU E:268 , GLU E:269 , ILE E:270 , ASN E:289binding site for Mono-Saccharide NAG E 505 bound to ASN E 289
06AC6SOFTWAREASN E:295 , THR E:297 , LYS E:442 , ASN E:444 , ASN G:80binding site for Mono-Saccharide NAG E 506 bound to ASN E 295
07AC7SOFTWAREASN E:334 , LYS E:337 , THR E:413 , THR G:77binding site for Mono-Saccharide NAG E 507 bound to ASN E 334
08AC8SOFTWARELEU E:369 , MET E:373 , ASN E:386 , THR E:388 , GLN G:114 , GLN G:117binding site for Mono-Saccharide NAG E 508 bound to ASN E 386
09AC9SOFTWAREASN E:392 , THR E:394 , CYS E:395 , MET E:407 , CYS E:410binding site for Mono-Saccharide NAG E 509 bound to ASN E 392
10AD1SOFTWARECYS E:395 , THR E:406 , MET E:407 , ASN E:411binding site for Mono-Saccharide NAG E 510 bound to ASN E 411
11AD2SOFTWAREGLU G:83 , ASN G:229 , ASN G:241 , SER G:243binding site for Mono-Saccharide NAG G 501 bound to ASN G 241
12AD3SOFTWARELYS G:252 , VAL G:254 , LEU G:261 , ASN G:262 , VAL G:446 , SER G:447binding site for Mono-Saccharide NAG G 502 bound to ASN G 262
13AD4SOFTWAREILE G:270 , ASN G:289 , GLN G:344binding site for Mono-Saccharide NAG G 503 bound to ASN G 289
14AD5SOFTWAREASN G:295 , THR G:297binding site for Mono-Saccharide NAG G 504 bound to ASN G 295
15AD6SOFTWAREASN G:334 , LYS G:337 , THR G:413binding site for Mono-Saccharide NAG G 505 bound to ASN G 334
16AD7SOFTWAREASN G:392 , THR G:394 , MET G:407 , LYS G:408 , GLY G:409 , CYS G:410binding site for Mono-Saccharide NAG G 506 bound to ASN G 392

(-) SS Bonds  (24, 24)

Asymmetric Unit
No.Residues
1E:54 -E:74
2E:119 -E:205
3E:218 -E:247
4E:228 -E:239
5E:296 -E:331
6E:378 -E:445
7E:385 -E:418
8E:395 -E:410
9F:22 -F:92
10F:140 -F:196
11G:54 -G:74
12G:119 -G:205
13G:218 -G:247
14G:228 -G:239
15G:296 -G:331
16G:378 -G:445
17G:385 -G:418
18G:395 -G:410
19H:22 -H:96
20H:152 -H:208
21I:23 -I:88
22I:134 -I:193
23L:23 -L:88
24L:134 -L:193

(-) Cis Peptide Bonds  (15, 15)

Asymmetric Unit
No.Residues
1Phe H:158 -Pro H:159
2Glu H:160 -Pro H:161
3Ser L:9 -Ala L:11
4Gly L:29 -Gly L:30
5Gly L:95 -Ser L:95A
6Ser L:95A-Ile L:95B
7Ala L:111 -Ala L:112
8Tyr L:140 -Pro L:141
9Phe F:146 -Pro F:147
10Glu F:148 -Pro F:149
11Ser I:9 -Ala I:11
12Gly I:29 -Gly I:30
13Gly I:95 -Ser I:95A
14Ser I:95A-Ile I:95B
15Tyr I:140 -Pro I:141

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4YFL)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4YFL)

(-) Exons   (0, 0)

(no "Exon" information available for 4YFL)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain E from PDB  Type:PROTEIN  Length:347
                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eee........hhhhhhhhhhh........eeee....eeee....hhhhhhhhhhhhhhhhhh...eeee..eeee.............eee....eeeeee.......eeee..eeee.............eee.........eee..........eeeeeeeeeeeeeee.......eeeeeeehhhhhhhhhhhhhhhhhhh...eeee......hhhhhheeeee..eeeee.hhhhhhhhhh..........eeeeeeee..eee......eee........eeeeeeeeeeeeee........eeeeee....hhhhhhhhhh.eeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4yfl E   44 VWKDADTTLFCASDAKAHETEVHNVWATHACVPTDPNPQEIHLENVTENFNMWKNNMVEQMQEDVISLWDQSLQPCVKLTGGSVIKQACPKISFDPIPIHYCTPAGYVILKCNDKNFNGTGPCKNVSSVQCTHGIKPVVSTQLLLNGSLAEEEIIIRSENLTNNAKTIIVHLNKSVEINCTRPSNGDIRKAYCEINGTKWNKVLKQVTEKLKEHFNNKTIIFQPPSGGDLEITMHHFNCRGEFFYCNTTQLFNNTCIGNETMKGCNGTITLPCKIKQIINMWQGTGQAMYAPPIDGKINCVSNITGILLTRDGGANNTSNETFRPGGGNIKDNWRSELYKYKVVQIE  492
                                    53        63        73        83        93       103       113       123||     206       216       226       236       246       256       266       276       286       296    || 328       338       348      |359       369       379       389       405       415       425       435       445       455       465       475       485       
                                                                                                          124|                                                                                                    301|                            355|                                     397|                                                                                        
                                                                                                           198                                                                                                     324                             357                                      404                                                                                        


Chain F from PDB  Type:PROTEIN  Length:221
                                                                                                                                                                                                                                                              
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee............eeee..hhhhh....eeeee......eeeeee......eee.......ee..ee....eeeeee.........eeeee..................................eee..........eeeeeeeeee......eee.........eee.........eeeeeeeee.........eeeeeee....eeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4yfl F    3 QLEQSGTAVRKPGASVTLSCQASGYNFVKYIIHWVRQKPGLGFEWVGMIDPYRGRPWSAHKFQGRLSLSRDTSMEILYMTLTSLKSDDTATYFCARAEAASDSHSRPIMFDHWGQGSLVTVSSASTKGPSVFPLAPSSKGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK  214
                                    12        22        32        42        52|       61        71        81 |||    88        98  ||||100H       110       120       133       143       153       163       173       183       193       203       213 
                                                                            52A                            82A||               100A|||||||                          129|                                                                                 
                                                                                                            82B|                100B||||||                           133                                                                                 
                                                                                                             82C                 100C|||||                                                                                                               
                                                                                                                                  100D||||                                                                                                               
                                                                                                                                   100E|||                                                                                                               
                                                                                                                                    100F||                                                                                                               
                                                                                                                                     100G|                                                                                                               
                                                                                                                                      100H                                                                                                               


Chain G from PDB  Type:PROTEIN  Length:347
                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.....eee........hhhhhhhhhhh................eeee...hhhhhhhhhhhhhhhhhhh...eeee..eeee.............eee....eeeeee.......eeee..eeee.............eee.........eeee.........eeeeeeeeeeeeeee.......eeeeeeehhhhhhhhhhhhhhhhhhh...eeee......hhhhhheeeee..eeeee.hhhhhhhhhh..........eeeeeeee..eeee....eeee........eeeeeeeeeeeeee........eeeeee...hhhhhhhhhhh.eeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4yfl G   44 VWKDADTTLFCASDAKAHETEVHNVWATHACVPTDPNPQEIHLENVTENFNMWKNNMVEQMQEDVISLWDQSLQPCVKLTGGSVIKQACPKISFDPIPIHYCTPAGYVILKCNDKNFNGTGPCKNVSSVQCTHGIKPVVSTQLLLNGSLAEEEIIIRSENLTNNAKTIIVHLNKSVEINCTRPSNGDIRKAYCEINGTKWNKVLKQVTEKLKEHFNNKTIIFQPPSGGDLEITMHHFNCRGEFFYCNTTQLFNNTCIGNETMKGCNGTITLPCKIKQIINMWQGTGQAMYAPPIDGKINCVSNITGILLTRDGGANNTSNETFRPGGGNIKDNWRSELYKYKVVQIE  492
                                    53        63        73        83        93       103       113       123||     206       216       226       236       246       256       266       276       286       296    || 328       338       348      |359       369       379       389       405       415       425       435       445       455       465       475       485       
                                                                                                          124|                                                                                                    301|                            355|                                     397|                                                                                        
                                                                                                           198                                                                                                     324                             357                                      404                                                                                        


Chain H from PDB  Type:PROTEIN  Length:223
                                                                                                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee...ee........eeee..hhhhhh.eeeee..........eee......eee.hhhh...eee........eee...........eeee........................ee........eeeee........eeeeeeeee..........hhhhh.....eee............eeeeeee........eeeeeee....eeeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4yfl H    3 QLEQSGTAVRKPGASVTLSCQASGYNFVKYIIHWVRQKPGLGFEWVGMIDPYRGRPWSAHKFQGRLSLSRDTSMEILYMTLTSLKSDDTATYFCARAEAASDSHSRPIMFDHWGQGSLVTVSSASTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS  227
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       144       154       164       174       184       194       204       214       224   
                                                                                                                                                                    141|                                                                                   
                                                                                                                                                                     144                                                                                   


Chain I from PDB  Type:PROTEIN  Length:200
                                                                                                                                                                                                                                         
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............eeeeee..........eeeee.......ee.......................eeeeee.........ee.eee.............ee......ee..hhhhhh...eeeee.eeee....ee...ee..ee....eee..........eee.eeeeehhhhhh.......eeee..eeee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4yfl I    5 TQPPSASGAPGQRVTISCSGGPSNVGGNYVYWYRQFPGTAPTLLILRDDQRPSGVPDRFSASKSGNSASLAISGLRPDDEGFYFCATYDSDGSIRLFGGGTALTPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAP  208
                                ||  15        25  ||    33        43        53        63        73        83        93  ||   101   ||  118       128       138       148       158       168       178       188       198       208
                                9|              27A|                                                                  95A|       105|                                                                                               
                                11               27B                                                                   95B        113                                                                                               


Chain L from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                  
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .................eee..............ee...........................ee........eee.........ee.ee..............ee..........eee..hhhhhhh.....eeeeeee.........ee..ee.................eeeee....hhhhhh...................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4yfl L    1 QSALTQPPSASGAPGQRVTISCSGGPSNVGGNYVYWYRQFPGTAPTLLILRDDQRPSGVPDRFSASKSGNSASLAISGLRPDDEGFYFCATYDSDGSIRLFGGGTALTVPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAP  208
                                    11        21      ||29        39        49        59        69        79        89      ||97       109       119       129       139       149       159       169       179       189       199         
                                    9|              27A|                                                                  95A|        106|                                                                                                   
                                    11               27B                                                                   95B         109
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4YFL)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4YFL)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4YFL)

(-) Gene Ontology  (14, 14)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala L:111 - Ala L:112   [ RasMol ]  
    Glu F:148 - Pro F:149   [ RasMol ]  
    Glu H:160 - Pro H:161   [ RasMol ]  
    Gly I:29 - Gly I:30   [ RasMol ]  
    Gly I:95 - Ser I:95A  [ RasMol ]  
    Gly L:29 - Gly L:30   [ RasMol ]  
    Gly L:95 - Ser L:95A  [ RasMol ]  
    Phe F:146 - Pro F:147   [ RasMol ]  
    Phe H:158 - Pro H:159   [ RasMol ]  
    Ser I:9 - Ala I:11   [ RasMol ]  
    Ser I:95A - Ile I:95B  [ RasMol ]  
    Ser L:9 - Ala L:11   [ RasMol ]  
    Ser L:95A - Ile L:95B  [ RasMol ]  
    Tyr I:140 - Pro I:141   [ RasMol ]  
    Tyr L:140 - Pro L:141   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4yfl
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q0ED31_9HIV1 | Q0ED31
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q0ED31_9HIV1 | Q0ED31
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q0ED31_9HIV1 | Q0ED31: 3ngb 3se8 3se9 3tgt 3u7y 4dko 4dkp 4dkq 4dkr 4dku 4dkv 4dvs 4dvt 4dvv 4dvw 4dvx 4h8w 4i54 4jb9 4jdt 4jkp 4jpv 4jpw 4lsp 4lsq 4lsr 4lsu 4olu 4olv 4olw 4olx 4oly 4olz 4om0 4om1 4p9h 4rfn 4rfo 4rz8 4xnz 4xvt 4ydj 4ydk 4ydl

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4YFL)