Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF C-TERMINAL MODIFIED TAU PEPTIDE-HYBRID 201D WITH 14-3-3SIGMA
 
Authors :  M. Bartel, L. G. Milroy, L. Brunsveld, C. Ottmann
Date :  10 Feb 15  (Deposition) - 23 Dec 15  (Release) - 27 Jan 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  14-3-3 Fold, Tau, All Alpha-Helical, Adapter Protein, Protein-Protein Interaction, Peptide Binding Protein, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. G. Milroy, M. Bartel, M. A. Henen, S. Leysen, J. M. Adriaans, L. Brunsveld, I. Landrieu, C. Ottmann
Stabilizer-Guided Inhibition Of Protein-Protein Interactions.
Angew. Chem. Int. Ed. Engl. V. 54 15720 2015
PubMed-ID: 26537010  |  Reference-DOI: 10.1002/ANIE.201507976

(-) Compounds

Molecule 1 - 14-3-3 PROTEIN SIGMA
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: SFN, HME1
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: EPITHELIAL CELL MARKER PROTEIN 1,STRATIFIN
 
Molecule 2 - ARG-THR-PRO-SEP-LEU-PRO-THR-[H][C@@]1(C(C2=CC=CC=C2) C3=CC=CC=C3)CCCN1C
    Chains: C, D
    Engineered: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Other Details: THE C-TERMINAL PROLINE CONTAINS CHEMICAL MODIFICATIONS
    Synthetic: YES

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric/Biological Unit (2, 3)
No.NameCountTypeFull Name
149F1Ligand/Ion(2S)-2-(2-METHOXYETHYL)PYRROLIDINE
2SEP2Mod. Amino AcidPHOSPHOSERINE

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:42 , SER A:45 , VAL A:46 , PHE A:119 , ALA B:203 , PRO C:216 , THR C:217binding site for residue 49F C 301
2AC2SOFTWARELYS A:49 , ARG A:56 , ARG A:129 , TYR A:130 , ASN A:175 , VAL A:178 , ASN A:226 , ARG C:211 , THR C:212 , LEU C:215 , PRO C:216 , HOH C:404 , HOH C:405 , HOH C:406 , HOH C:407 , HOH C:409binding site for Di-peptide PRO C 213 and SEP C 214
3AC3SOFTWARELYS A:49 , ARG A:56 , ARG A:129 , TYR A:130 , LEU A:174 , ASN A:175 , THR C:212 , PRO C:213 , PRO C:216 , THR C:217 , HOH C:404 , HOH C:405 , HOH C:406 , HOH C:407 , HOH C:409binding site for Di-peptide SEP C 214 and LEU C 215
4AC4SOFTWARELYS B:49 , ARG B:56 , ARG B:129 , TYR B:130 , ASN B:175 , VAL B:178 , ASN B:226 , THR D:212 , LEU D:215 , PRO D:216 , HOH D:301 , HOH D:303 , HOH D:304 , HOH D:305 , HOH D:306 , HOH D:307binding site for Di-peptide PRO D 213 and SEP D 214
5AC5SOFTWARELYS B:49 , ARG B:56 , ARG B:129 , TYR B:130 , LEU B:174 , ASN B:175 , THR D:212 , PRO D:213 , PRO D:216 , HOH D:301 , HOH D:303 , HOH D:304 , HOH D:305 , HOH D:306 , HOH D:307binding site for Di-peptide SEP D 214 and LEU D 215

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4Y3B)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Ser B:105 -His B:106

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4Y3B)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4Y3B)

(-) Exons   (0, 0)

(no "Exon" information available for 4Y3B)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:229
                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4y3b A  -4 GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT 231
                                     5        15        25        35        45        55        65    ||  81        91       101       111       121       131     ||142       152       162       172       182       192       202       212       222         
                                                                                                     70|                                                         137|                                                                                            
                                                                                                      77                                                          139                                                                                            


Chain B from PDB  Type:PROTEIN  Length:234
                                                                                                                                                                                                                                                                          
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4y3b B  -4 GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNESEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT 231
                                     5        15        25        35        45        55        65    ||| 77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227    
                                                                                                     70||                                                                                                                                                             
                                                                                                      72|                                                                                                                                                             
                                                                                                       74                                                                                                                                                             


Chain C from PDB  Type:PROTEIN  Length:7
                                       
               SCOP domains ------- SCOP domains
               CATH domains ------- CATH domains
               Pfam domains ------- Pfam domains
         Sec.struct. author ....... Sec.struct. author
                 SAPs(SNPs) ------- SAPs(SNPs)
                    PROSITE ------- PROSITE
                 Transcript ------- Transcript
                 4y3b C 211 RTPsLPT 217
                               |   
                             214-SEP


Chain D from PDB  Type:PROTEIN  Length:6
                                      
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                 4y3b D 212 TPsLPT 217
                              |   
                              |   
                            214-SEP
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4Y3B)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4Y3B)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4Y3B)

(-) Gene Ontology  (81, 87)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    49F  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SEP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ser B:105 - His B:106   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4y3b
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  1433S_HUMAN | P31947
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  TAU_HUMAN | P10636
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  1433S_HUMAN | P31947
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TAU_HUMAN | P10636
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        1433S_HUMAN | P31947: 1ywt 1yz5 3iqj 3iqu 3iqv 3lw1 3mhr 3o8i 3p1n 3p1o 3p1p 3p1q 3p1r 3p1s 3smk 3sml 3smm 3smn 3smo 3sp5 3spr 3t0l 3t0m 3u9x 3ux0 4dat 4dau 4dhm 4dhn 4dho 4dhp 4dhq 4dhr 4dhs 4dht 4dhu 4fl5 4fr3 4hqw 4hru 4iea 4jc3 4jdd 4qli 4y32 4y5i 5btv 5hf3 5ltw 5lu1 5lu2 5my9 5myc
        TAU_HUMAN | P10636: 1i8h 2mz7 2on9 3ovl 4e0m 4e0n 4e0o 4fl5 4glr 4np8 4tqe 4y32 4y5i 5dmg 5e2v 5e2w 5hf3 5k7n

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4Y3B)