Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  SAC3N PEPTIDE BOUND TO MEX67:MTR2
 
Authors :  S. Aibara, E. Valkov, M. Stewart
Date :  26 Nov 14  (Deposition) - 17 Jun 15  (Release) - 15 Jul 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.85
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Mrna Nuclear Export; Trex-2, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. Dimitrova, E. Valkov, S. Aibara, D. Flemming, S. H. Mclaughlin, E. Hurt, M. Stewart
Structural Characterization Of The Chaetomium Thermophilum Trex-2 Complex And Its Interaction With The Mrna Nuclear Export Factor Mex67:Mtr2.
Structure V. 23 1246 2015
PubMed-ID: 26051714  |  Reference-DOI: 10.1016/J.STR.2015.05.002

(-) Compounds

Molecule 1 - PUTATIVE MRNA EXPORT PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 365-564
    Gene: CTHT_0059630
    Organism Scientific: CHAETOMIUM THERMOPHILUM
    Organism Taxid: 759272
    Strain: DSM 1495 / CBS 144.50 / IMI 039719
 
Molecule 2 - PUTATIVE UNCHARACTERIZED PROTEIN
    Chains: B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 12-187
    Gene: CTHT_0065500
    Organism Scientific: CHAETOMIUM THERMOPHILUM
    Organism Taxid: 759272
    Strain: DSM 1495 / CBS 144.50 / IMI 039719
 
Molecule 3 - PUTATIVE SAC3 FAMILY PROTEIN
    Chains: C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 20-40
    Gene: CTHT_0066750
    Organism Scientific: CHAETOMIUM THERMOPHILUM
    Organism Taxid: 759272
    Strain: DSM 1495 / CBS 144.50 / IMI 039719

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4X2O)

(-) Sites  (0, 0)

(no "Site" information available for 4X2O)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4X2O)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4X2O)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4X2O)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4X2O)

(-) Exons   (0, 0)

(no "Exon" information available for 4X2O)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:179
                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........ee....hhhhhhhhhhhhhhhhh..hhhhhhh....eeeeee..hhhhhhhhhhhhh..eeeeee..hhhhhhhhh.eee.....hhhhheeeeeeeeee.........eeeeeeeeeeeeeeee....eeeeeeeeeeeeeee........eeeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x2o A 364 SPTPLPQLPSNVRDGENNVASTFLQAFFQLWDHDRLTLIPQFYDSETTFSVVFAQDPASSSCSKFSRNLLQRLFVGSNLIADLWKVLPATRHPSLDQTSQWLIDCHTFPHLADPTGMAPYAMGLMINVNGQCEEADISQNLYGTRTFSRCFILGPSKPGAPHPYRVLSDQLTLHTWKPQ 556
                                   373       383       393       403       413   ||  427       447       457       467       477       487       497       507       517       527       537       547         
                                                                               417|           436|                                                                                                             
                                                                                422            447                                                                                                             


Chain B from PDB  Type:PROTEIN  Length:175
                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.....eeee..eee.hhhhhhhhhhhhhh...........eeeeeeeeeeeeeeee.......hhhhhhhhhhhhh...eeeeeeeeeeeeee.........eeeeeeeeeeeeehhhhhh......eeeeeeeeeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x2o B   3 SRRYAAKSFVEWYYRQINENKPVASGYVNNNATYTKAGHPPADITINGRVVATPEEWDTMLKEQRAQHNTSTLPIGRKPVRYDVDCFDVHVINADYRFAAPQRMIEQHAPTDGVRMMMALTVSGSVYFGASPRSTDDYVIKQHFNDVFILVPNWDVLEKRSGRKYLIASHKYRAY 183
                                    12        22        32        42        52        62        72|       85        95       105       115       125       135       145       155       168       178     
                                                                                                72|                                                                                     164|               
                                                                                                 76                                                                                      168               


Chain C from PDB  Type:PROTEIN  Length:8
                                        
               SCOP domains -------- SCOP domains
               CATH domains -------- CATH domains
               Pfam domains -------- Pfam domains
         Sec.struct. author ........ Sec.struct. author
                 SAPs(SNPs) -------- SAPs(SNPs)
                    PROSITE -------- PROSITE
                 Transcript -------- Transcript
                 4x2o C  30 SSVFGAPA  37
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4X2O)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4X2O)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4X2O)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4x2o)
 
  Sites
(no "Sites" information available for 4x2o)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4x2o)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4x2o
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  G0SET4_CHATD | G0SET4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  G0SG92_CHATD | G0SG92
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  G0SGL4_CHATD | G0SGL4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  G0SET4_CHATD | G0SET4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  G0SG92_CHATD | G0SG92
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  G0SGL4_CHATD | G0SGL4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        G0SET4_CHATD | G0SET4: 4wp2 4wp5 4wp6 4wpm 4x2h 4xm4
        G0SG92_CHATD | G0SG92: 4wp5 4x2h 4x2m
        G0SGL4_CHATD | G0SGL4: 4wpx 4x2h

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4X2O)