Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CHAETOMIUM THERMOPHILUM MEX67 NTF2-LIKE DOMAIN COMPLEXED WITH MTR2
 
Authors :  S. Aibara, E. Valkov, M. Stewart
Date :  17 Oct 14  (Deposition) - 15 Jul 15  (Release) - 15 Jul 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Nuclear Export Factor, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Aibara, E. Valkov, M. H. Lamers, L. Dimitrova, E. Hurt, M. Stewart
Structural Characterization Of The Principal Mrna-Export Factor Mex67-Mtr2 From Chaetomium Thermophilum.
Acta Crystallogr. , Sect. F V. 71 876 2015
PubMed-ID: 26144233  |  Reference-DOI: 10.1107/S2053230X15008766

(-) Compounds

Molecule 1 - MRNA EXPORT PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Taxid: 469008
    Fragment: UNP RESIDUES 365-564
    Gene: CTHT_0059630
    Organism Scientific: CHAETOMIUM THERMOPHILUM
    Organism Taxid: 759272
    Strain: DSM 1495 / CBS 144.50 / IMI 039719
 
Molecule 2 - MTR2
    Chains: B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Taxid: 469008
    Fragment: UNP RESIDUES 11-187
    Gene: CTHT_0065500
    Organism Scientific: CHAETOMIUM THERMOPHILUM
    Organism Taxid: 759272
    Strain: DSM 1495 / CBS 144.50 / IMI 039719

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4WP5)

(-) Sites  (0, 0)

(no "Site" information available for 4WP5)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4WP5)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4WP5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4WP5)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4WP5)

(-) Exons   (0, 0)

(no "Exon" information available for 4WP5)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:199
                                                                                                                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .................hhhhhhhhhhhhhhhhhh.hhhhhhh....eeeeee......hhhhhhhhhhhhhh..........eeeee..hhhhhhh...eee.....hhhhheeeeeeeeeee.......eeeeeeeeeeeeeeeee....eeeeeeeeeeeeeee........eeeeeeeeeeeeeee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4wp5 A 364 MPTPLPQLPSNVRDGENNVASTFLQAFFQLWDHDRLTLIPQFYDSETTFSVVFATDSPQDPASSSCSKFSRNLNILSPPSTLQRLFVGSNLIADLWKVLPATRHPSLDQTSQWLIDCHTFPHLADPTGMAPYAMGLMINVNGQCEEADISQNLYGTRTFSRCFILGPSKPGAPHPYRVLSDQLTLHTWKPQPAPQVGTV 564
                                   373       383       393       403       413       423       433       445       455       465       475       485       495       505       515       525       535       545       555         
                                                                                                       441|                                                                                                                        
                                                                                                        444                                                                                                                        


Chain B from PDB  Type:PROTEIN  Length:171
                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh....eeee..eee.hhhhhhhhhhhhh...eeeeeeeeeeeeeeee.......hhhhhhhh........eeeeeeeeeeeeee.........eeeeeeeeeeeee..........hhhhheeeeeeee.ee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4wp5 B   1 MLSRRYAAKSFVEWYYRQINENKPVASGYVNNNATYTKAGHPPADITINGRVVATPEEWDTMLKEQRAGRKPVRYDVDCFDVHVINADYRFAAPQRMIEQHAPTDGVRMMMALTVSGSVYFGASPRSTDDYVIKQHFNDVFILVPNWDVLEKPGARSARKYLIASHKYRAY 183
                                    10        20        30        40        50        60       |82        92       102       112       122       132       142       152       162       172       182 
                                                                                              68|                                                                                                      
                                                                                               81
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4WP5)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4WP5)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4WP5)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4wp5)
 
  Sites
(no "Sites" information available for 4wp5)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4wp5)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4wp5
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  G0SET4_CHATD | G0SET4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  G0SG92_CHATD | G0SG92
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  G0SET4_CHATD | G0SET4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  G0SG92_CHATD | G0SG92
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        G0SET4_CHATD | G0SET4: 4wp2 4wp6 4wpm 4x2h 4x2o 4xm4
        G0SG92_CHATD | G0SG92: 4x2h 4x2m 4x2o

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4WP5)