Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF MTR2
 
Authors :  S. Aibara, E. Valkov, M. Stewart
Date :  26 Nov 14  (Deposition) - 15 Jul 15  (Release) - 15 Jul 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Mrna Nuclear Export Factor, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Aibara, E. Valkov, M. H. Lamers, L. Dimitrova, E. Hurt, M. Stewart
Structural Characterization Of The Principal Mrna-Export Factor Mex67-Mtr2 From Chaetomium Thermophilum.
Acta Crystallogr. , Sect. F V. 71 876 2015
PubMed-ID: 26144233  |  Reference-DOI: 10.1107/S2053230X15008766

(-) Compounds

Molecule 1 - MTR2
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneCTHT_0065500
    Organism ScientificCHAETOMIUM THERMOPHILUM
    Organism Taxid759272
    StrainDSM 1495 / CBS 144.50 / IMI 039719

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4X2M)

(-) Sites  (0, 0)

(no "Site" information available for 4X2M)

(-) SS Bonds  (1, 1)

Asymmetric Unit
No.Residues
1A:91 -B:91

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4X2M)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4X2M)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4X2M)

(-) Exons   (0, 0)

(no "Exon" information available for 4X2M)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:177
                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.....eeee..eee.hhhhhhhhhhhhhhhh............eeeeeeeeeeeeeeee.......hhhhhhhh........eeeeeeeeeeeeee.........eeeeeeeeeeeeehhhhhh....eeeeeeeeeee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x2m A   2 LSRRYAAKSFVEWYYRQINENKPVASGYVNNNATYTKAGHPPADITINGRVVATPEEWDTMLKEQRAQHNTSSSSTLPIGRKPVRYDVDCFDVHVINADYRFAAPQRMIEQHAPTDGVRMMMALTVSGSVYFGASPRSTDDYVIKQHFNDVFILVPNWDVLEKGRKYLIASHKYRAY 183
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161  ||   176       
                                                                                                                                                                                            164|             
                                                                                                                                                                                             170             

Chain B from PDB  Type:PROTEIN  Length:177
                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.....eeee..eee.hhhhhhhhhhhhhhhh............eeeeeeeeeeeeeeee.......hhhhhhhh........eeeeeeeeeeeeee.........eeeeeeeeeeeeehhhhhhh...eeeeeeeeeee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x2m B   2 LSRRYAAKSFVEWYYRQINENKPVASGYVNNNATYTKAGHPPADITINGRVVATPEEWDTMLKEQRAQHNTSSSSTLPIGRKPVRYDVDCFDVHVINADYRFAAPQRMIEQHAPTDGVRMMMALTVSGSVYFGASPRSTDDYVIKQHFNDVFILVPNWDVLEKGRKYLIASHKYRAY 183
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161  ||   176       
                                                                                                                                                                                            164|             
                                                                                                                                                                                             170             

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4X2M)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4X2M)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4X2M)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 4X2M)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4x2m)
 
  Sites
(no "Sites" information available for 4x2m)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4x2m)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4x2m
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  G0SG92_CHATD | G0SG92
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  G0SG92_CHATD | G0SG92
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        G0SG92_CHATD | G0SG924wp5 4x2h 4x2o

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4X2M)