Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  ALKYLPEROXO REACTION INTERMEDIATE TRAPPED IN PROTOCATECHUATE 3,4-DIOXYGENASE (PSEUDOMONAS PUTIDA) AT PH 6.5
 
Authors :  C. J. Knoot, V. M. Purpero, J. D. Lipscomb
Date :  23 Sep 14  (Deposition) - 31 Dec 14  (Release) - 28 Jan 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.78
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,B,C,D,E,F  (4x)
Keywords :  Dioxygen Activation, Non-Heme Iron, Intradiol Dioxygenase, Aromatic Ring Cleavage, Catalytic Intermediates, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. J. Knoot, V. M. Purpero, J. D. Lipscomb
Crystal Structures Of Alkylperoxo And Anhydride Intermediates In An Intradiol Ring-Cleaving Dioxygenase.
Proc. Natl. Acad. Sci. Usa V. 112 388 2015
PubMed-ID: 25548185  |  Reference-DOI: 10.1073/PNAS.1419118112

(-) Compounds

Molecule 1 - PROTOCATECHUATE 3,4-DIOXYGENASE ALPHA CHAIN
    Chains: A, E, C
    EC Number: 1.13.11.3
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PCE120K
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: PCAG
    Organism Scientific: PSEUDOMONAS PUTIDA
    Organism Taxid: 303
    Synonym: 3,4-PCD
 
Molecule 2 - PROTOCATECHUATE 3,4-DIOXYGENASE BETA CHAIN
    Chains: F, D, B
    EC Number: 1.13.11.3
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PCE120K
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: PCAH
    Organism Scientific: PSEUDOMONAS PUTIDA
    Organism Taxid: 303
    Synonym: 3,4-PCD

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABCDEF
Biological Unit 1 (4x): ABCDEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (9, 38)

Asymmetric Unit (9, 38)
No.NameCountTypeFull Name
13N817Ligand/Ion4-FLUOROBENZENE-1,2-DIOL
23N91Ligand/Ion(6S)-4-FLUORO-6-HYDROPEROXY-6-HYDROXYCYCLOHEXA-2,4-DIEN-1-ONE
3BCT3Ligand/IonBICARBONATE ION
4BME8Ligand/IonBETA-MERCAPTOETHANOL
5CL3Ligand/IonCHLORIDE ION
6FE3Ligand/IonFE (III) ION
7GOL1Ligand/IonGLYCEROL
8NA1Ligand/IonSODIUM ION
9SO41Ligand/IonSULFATE ION
Biological Unit 1 (6, 124)
No.NameCountTypeFull Name
13N868Ligand/Ion4-FLUOROBENZENE-1,2-DIOL
23N94Ligand/Ion(6S)-4-FLUORO-6-HYDROPEROXY-6-HYDROXYCYCLOHEXA-2,4-DIEN-1-ONE
3BCT12Ligand/IonBICARBONATE ION
4BME32Ligand/IonBETA-MERCAPTOETHANOL
5CL-1Ligand/IonCHLORIDE ION
6FE-1Ligand/IonFE (III) ION
7GOL4Ligand/IonGLYCEROL
8NA-1Ligand/IonSODIUM ION
9SO44Ligand/IonSULFATE ION

(-) Sites  (38, 38)

Asymmetric Unit (38, 38)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASN A:37 , THR A:105 , HIS A:107binding site for residue CL A 301
02AC2SOFTWAREPRO A:164 , ARG A:167 , GLU A:168 , ILE A:171 , HOH A:461binding site for residue 3N8 A 302
03AC3SOFTWAREHIS A:61 , LEU A:62binding site for residue CL A 303
04AC4SOFTWAREPRO E:164 , ARG E:167 , GLU E:168 , ILE E:171 , HOH E:488binding site for residue 3N8 E 301
05AC5SOFTWARETYR F:408 , TYR F:447 , HIS F:460 , HIS F:462 , HOH F:865binding site for residue FE F 601
06AC6SOFTWARELYS F:493 , ILE F:495 , ALA F:496 , VAL F:501 , BME F:606binding site for residue 3N8 F 602
07AC7SOFTWAREPRO D:322 , ILE D:328 , ARG F:333 , HOH F:838 , HOH F:849binding site for residue 3N8 F 603
08AC8SOFTWAREARG D:450 , MET D:516 , SER F:338 , ILE F:339 , PRO F:340binding site for residue 3N8 F 604
09AC9SOFTWARETHR F:321 , PRO F:322 , ASP F:323 , HOH F:815binding site for residue BME F 605
10AD1SOFTWAREGLN F:502 , ILE F:505 , 3N8 F:602binding site for residue BME F 606
11AD2SOFTWAREARG F:409 , PRO F:421 , HOH F:854binding site for residue BCT F 607
12AD3SOFTWAREASN E:28 , PRO E:29 , ASN F:366 , GLY F:424 , GLY F:425 , VAL F:426binding site for residue 3N8 F 608
13AD4SOFTWAREARG F:409 , HIS F:410 , LEU F:419binding site for residue BCT F 609
14AD5SOFTWAREGLN F:503 , ARG F:522 , PHE F:523 , ASP F:524binding site for residue BME F 610
15AD6SOFTWAREPRO C:164 , ARG C:167 , GLU C:168 , ILE C:171 , HOH C:434binding site for residue 3N8 C 301
16AD7SOFTWAREGLU C:168 , ILE C:171 , ARG C:184 , PHE C:185 , ASP C:186 , HOH C:517binding site for residue BME C 302
17AD8SOFTWAREASN C:37 , THR C:105 , HIS C:107binding site for residue CL C 303
18AD9SOFTWAREHIS C:61 , LEU C:62 , ARG C:64 , HOH C:488 , GLN E:163 , GLN E:165binding site for residue SO4 C 304
19AE1SOFTWARETYR D:408 , TYR D:447 , HIS D:460 , HIS D:462 , HOH D:882binding site for residue FE D 601
20AE2SOFTWAREASN C:28 , PRO C:29 , THR C:30 , ASN D:366 , GLY D:424 , GLY D:425 , VAL D:426binding site for residue 3N8 D 602
21AE3SOFTWARELYS D:493 , ILE D:495 , ALA D:496 , HOH D:831binding site for residue 3N8 D 603
22AE4SOFTWAREPRO B:322 , ILE B:328 , ARG D:333 , HOH D:874binding site for residue 3N8 D 604
23AE5SOFTWAREGLN D:530 , ARG D:531 , LYS D:532 , HOH D:810 , HOH D:869binding site for residue 3N8 D 605
24AE6SOFTWAREGLN D:503 , ARG D:522 , ASP D:524binding site for residue BME D 606
25AE7SOFTWARETHR D:321 , PRO D:322 , ASP D:323 , HOH D:835binding site for residue NA D 607
26AE8SOFTWAREASN B:514 , PRO B:515 , ARG D:307 , PHE D:308 , GLN D:341 , ARG D:531 , GLU D:536 , HOH D:729binding site for residue GOL D 608
27AE9SOFTWARETYR B:408 , TYR B:447 , HIS B:460 , HIS B:462 , 3N9 B:612binding site for residue FE B 601
28AF1SOFTWARESER B:338 , PRO B:340 , ARG F:450 , PRO F:515 , MET F:516binding site for residue 3N8 B 602
29AF2SOFTWAREARG B:333 , HOH B:841 , ILE F:328binding site for residue 3N8 B 603
30AF3SOFTWARELYS B:493 , ILE B:495 , ALA B:496 , VAL B:501binding site for residue 3N8 B 604
31AF4SOFTWAREARG B:450 , MET B:516 , SER D:338 , PRO D:340 , HOH D:760binding site for residue 3N8 B 605
32AF5SOFTWARESER B:306 , GLN B:530binding site for residue BME B 606
33AF6SOFTWAREARG B:383 , ASP B:524 , HOH B:809 , HOH B:865binding site for residue 3N8 B 607
34AF7SOFTWAREGLN B:503 , ARG B:522 , ASP B:524binding site for residue BME B 608
35AF8SOFTWAREGLY B:482 , ASP B:483 , PRO B:487binding site for residue BME B 609
36AF9SOFTWAREGLY A:27 , ASN A:28 , ARG B:409 , HIS B:410 , LEU B:419binding site for residue 3N8 B 610
37AG1SOFTWAREARG B:383 , LYS D:390binding site for residue BCT B 611
38AG2SOFTWARETHR A:12 , GLY A:14 , PRO A:15 , TYR A:16 , HOH A:511 , TYR B:408 , TYR B:447 , TRP B:449 , ARG B:457 , HIS B:460 , HIS B:462 , GLN B:477 , ILE B:491 , FE B:601 , HOH B:872binding site for residue 3N9 B 612

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4WHQ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4WHQ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4WHQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4WHQ)

(-) Exons   (0, 0)

(no "Exon" information available for 4WHQ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:200
                                                                                                                                                                                                                                        
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhhhhh....................eeeeeeeee..........eeeee....................eeeee......eeeeeee....ee.....ee...eeeeee.......eeeeeee..hhhhhhh..hhhhh.hhhhhh..eeeeeee..eeeee..ee.........ee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4whq A   1 PIELLPETPSQTAGPYVHIGLALEAAGNPTRDQEIWNRLAKPDAPGEHILLLGQVYDGNGHLVRDSFLEVWQADANGEYQDAYNLENAFNSFGRTATTFDAGEWTLHTVKPGVVNNAAGVPMAPHINISLFARGINIHLHTRLYFDDEAQANAKCPVLNLIEQPQRRETLIAKRCEVDGKTAYRFDIRIQGEGETVFFDF 200
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200


Chain B from PDB  Type:PROTEIN  Length:238
                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee...............hhhhh........ee...hhhhhh.............................eeeeeeeeee.........eeeee.........................eeeee.....eeeeeee....eee.....eee..eeeeee........eeeeeee....hhhhh.hhhhh.hhhhhhh.eeee.hhhh.....eeee..eee..eee...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4whq B 301 PAQDNSRFVIRDRNWHPKALTPDYKTSIARSPRQALVSIPQSISETTGPNFSHLGFGAHDHDLLLNFNNGGLPIGERIIVAGRVVDQYGKPVPNTLVEMWQANAGGRYRHKNDRYLAPLDPNFGGVGRCLTDSDGYYSFRTIKPGPYPWRNGPNDWRPAHIHFGISGPSIATKLITQLYFEGDPLIPMCPIVKSIANPEAVQQLIAKLDMNNANPMDCLAYRFDIVLRGQRKTHFENC 538
                                   310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530        


Chain C from PDB  Type:PROTEIN  Length:200
                                                                                                                                                                                                                                        
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhhhhh....................eeeeeeeee..........eeeee....................eeeee......eeeeeee................eeeeee.......eeeeeee..hhhhhhh..hhhhh.hhhhhh..eeeeeee..eeeee..ee.........ee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4whq C   1 PIELLPETPSQTAGPYVHIGLALEAAGNPTRDQEIWNRLAKPDAPGEHILLLGQVYDGNGHLVRDSFLEVWQADANGEYQDAYNLENAFNSFGRTATTFDAGEWTLHTVKPGVVNNAAGVPMAPHINISLFARGINIHLHTRLYFDDEAQANAKCPVLNLIEQPQRRETLIAKRCEVDGKTAYRFDIRIQGEGETVFFDF 200
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200


Chain D from PDB  Type:PROTEIN  Length:238
                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......ee...............hhhhh........ee...hhhhhh.............................eeeeeeeeee.........eeeee.........................eeeee.....eeeeeee....eee.....eee..eeeeee........eeeeeee....hhhhh.hhhhh.hhhhhhh.eeee.hhhh.....eeee..eee..ee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4whq D 301 PAQDNSRFVIRDRNWHPKALTPDYKTSIARSPRQALVSIPQSISETTGPNFSHLGFGAHDHDLLLNFNNGGLPIGERIIVAGRVVDQYGKPVPNTLVEMWQANAGGRYRHKNDRYLAPLDPNFGGVGRCLTDSDGYYSFRTIKPGPYPWRNGPNDWRPAHIHFGISGPSIATKLITQLYFEGDPLIPMCPIVKSIANPEAVQQLIAKLDMNNANPMDCLAYRFDIVLRGQRKTHFENC 538
                                   310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530        


Chain E from PDB  Type:PROTEIN  Length:200
                                                                                                                                                                                                                                        
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhhhhh....................eeeeeeeee..........eeeee....................eeeee......eeeeeee....ee.....ee...eeeeee.......eeeeeee..hhhhhhhh.hhhhh.hhhhhh..eeeeeee..eeeee..ee.........ee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4whq E   1 PIELLPETPSQTAGPYVHIGLALEAAGNPTRDQEIWNRLAKPDAPGEHILLLGQVYDGNGHLVRDSFLEVWQADANGEYQDAYNLENAFNSFGRTATTFDAGEWTLHTVKPGVVNNAAGVPMAPHINISLFARGINIHLHTRLYFDDEAQANAKCPVLNLIEQPQRRETLIAKRCEVDGKTAYRFDIRIQGEGETVFFDF 200
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200


Chain F from PDB  Type:PROTEIN  Length:236
                                                                                                                                                                                                                                                                            
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......ee...............hhhhh........ee...hhhhhh.............................eeeeeeeeee.........eeeee.........................eeeee.....eeeeeee....eee.....eee...eeeee........eeeeeee....hhhhh.hhhhh.hhhhhhh.eeee.hhhh.....eeee..eee..ee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4whq F 301 PAQDNSRFVIRDRNWHPKALTPDYKTSIARSPRQALVSIPQSISETTGPNFSHLGFGAHDHDLLLNFNNGGLPIGERIIVAGRVVDQYGKPVPNTLVEMWQANAGGRYRHKNDRYLAPLDPNFGGVGRCLTDSDGYYSFRTIKPGPYPWRNGPNDWRPAHIHFGISGPSIATKLITQLYFEGDPLIPMCPIVKSIANPEAVQQLIAKLDMNNANPMDCLAYRFDIVLRGQRKTHFE 536
                                   310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4WHQ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4WHQ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4WHQ)

(-) Gene Ontology  (13, 24)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    3N8  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    3N9  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    BCT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    BME  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4whq)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4whq
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PCXA_PSEPU | P00436
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PCXB_PSEPU | P00437
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.13.11.3
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PCXA_PSEPU | P00436
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PCXB_PSEPU | P00437
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PCXA_PSEPU | P00436: 1ykk 1ykl 1ykm 1ykn 1yko 1ykp 2pcd 3lkt 3lmx 3lxv 3mfl 3mi1 3mi5 3mv4 3mv6 3pca 3pcb 3pcc 3pcd 3pce 3pcf 3pcg 3pch 3pci 3pcj 3pck 3pcl 3pcm 3pcn 3t63 3t67 4who 4whp 4whr 4whs
        PCXB_PSEPU | P00437: 1ykk 1ykl 1ykm 1ykn 1yko 1ykp 2pcd 3lkt 3lmx 3lxv 3mfl 3mi1 3mi5 3mv4 3mv6 3pca 3pcb 3pcc 3pcd 3pce 3pcf 3pcg 3pch 3pci 3pcj 3pck 3pcl 3pcm 3pcn 3t63 3t67 4who 4whp 4whr 4whs

(-) Related Entries Specified in the PDB File

4who 4whp 4whr 4whs