Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  THE X-RAY CRYSTAL STRUCTURE OF FULL-LENGTH TYPE I HUMAN PLASMINOGEN
 
Authors :  R. H. P. Law, T. Caradoc-Davies, J. C. Whisstock
Date :  22 Feb 12  (Deposition) - 28 Mar 12  (Release) - 26 Jun 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  5.20
Chains :  Asym./Biol. Unit :  A
Keywords :  Serine Protease, Fibrinolysis, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. H. P. Law, T. Caradoc-Davies, N. Cowieson, A. J. Horvath, A. J. Quek, J. A. Encarnacao, D. Steer, A. Cowan, Q. Zhang, B. G. C. Lu, R. N. Pike, A. I. Smith, P. B. Coughlin, J. C. Whisstock
The X-Ray Crystal Structure Of Full-Length Human Plasminoge
Cell Rep V. 1 185 2012
PubMed-ID: 22832192  |  Reference-DOI: 10.1016/J.CELREP.2012.02.012

(-) Compounds

Molecule 1 - PLASMINOGEN
    ChainsA
    EC Number3.4.21.7
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymSERINE PROTEASE
    TissuePLASMA

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4DUU)

(-) Sites  (0, 0)

(no "Site" information available for 4DUU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4DUU)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Ser A:112 -Pro A:113
2Ser A:194 -Pro A:195
3Thr A:386 -Pro A:387
4Glu A:490 -Pro A:491

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (18, 18)

Asymmetric/Biological Unit (18, 18)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_018657K38EPLMN_HUMANDisease (PLGD)73015965AK19E
02UniProtVAR_011779I46RPLMN_HUMANPolymorphism1049573AI27R
03UniProtVAR_016287E57KPLMN_HUMANPolymorphism4252070AE38K
04UniProtVAR_016288H133QPLMN_HUMANPolymorphism4252186AH114Q
05UniProtVAR_033653R134KPLMN_HUMANPolymorphism2817AR115K
06UniProtVAR_018658L147PPLMN_HUMANDisease (PLGD)770198253AL128P
07UniProtVAR_018659R235HPLMN_HUMANDisease (PLGD)121918030AR216H
08UniProtVAR_016289R261HPLMN_HUMANPolymorphism4252187AR242H
09UniProtVAR_006627V374FPLMN_HUMANDisease (PLGD)121918028AV355F
10UniProtVAR_016290R408WPLMN_HUMANPolymorphism4252119AR389W
11UniProtVAR_011780K453IPLMN_HUMANPolymorphism1804181AK434I
12UniProtVAR_016292A494VPLMN_HUMANPolymorphism4252128AA475V
13UniProtVAR_016293R523WPLMN_HUMANPolymorphism4252129AR504W
14UniProtVAR_018660R532HPLMN_HUMANDisease (PLGD)  ---AR513H
15UniProtVAR_006628S591PPLMN_HUMANDisease (PLGD)121918029AS572P
16UniProtVAR_006629A620TPLMN_HUMANDisease (PLGD)121918027AA601T
17UniProtVAR_031213V676DPLMN_HUMANPolymorphism17857492AV657D
18UniProtVAR_006630G751RPLMN_HUMANDisease (PLGD)121918033AG732R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (5, 12)

Asymmetric/Biological Unit (5, 12)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1KRINGLE_2PS50070 Kringle domain profile.PLMN_HUMAN102-181
184-262
274-352
376-454
480-560
  5A:83-162
A:165-243
A:255-255
A:357-435
A:461-541
2KRINGLE_1PS00021 Kringle domain signature.PLMN_HUMAN151-164
233-245
323-335
425-437
530-543
  4A:132-145
A:214-226
-
A:406-418
A:511-524
3TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.PLMN_HUMAN581-808  1A:562-789
4TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.PLMN_HUMAN618-623  1A:599-604
5TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.PLMN_HUMAN754-765  1A:735-746

(-) Exons   (18, 18)

Asymmetric/Biological Unit (18, 18)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000003081921bENSE00001900502chr6:161123274-161123385112PLMN_HUMAN1-17170--
1.2dENST000003081922dENSE00002186994chr6:161127439-161127574136PLMN_HUMAN17-62461A:3-4341
1.3aENST000003081923aENSE00002162767chr6:161128732-161128838107PLMN_HUMAN62-98371A:43-7937
1.4aENST000003081924aENSE00002147931chr6:161132109-161132223115PLMN_HUMAN98-136391A:79-11739
1.5bENST000003081925bENSE00002160428chr6:161134018-161134157140PLMN_HUMAN136-183481A:117-16448
1.6ENST000003081926ENSE00002153394chr6:161135826-161135946121PLMN_HUMAN183-223411A:164-20441
1.7ENST000003081927ENSE00002185478chr6:161137677-161137795119PLMN_HUMAN223-263411A:204-24441
1.8ENST000003081928ENSE00002162125chr6:161139326-161139488163PLMN_HUMAN263-317551A:244-25512
1.9ENST000003081929ENSE00002174772chr6:161139725-161139870146PLMN_HUMAN317-366501A:346-3472
1.10ENST0000030819210ENSE00002171287chr6:161143440-161143599160PLMN_HUMAN366-419541A:347-40054
1.11cENST0000030819211cENSE00002163078chr6:161152083-161152264182PLMN_HUMAN419-480621A:400-461 (gaps)62
1.12bENST0000030819212bENSE00002160674chr6:161152777-161152925149PLMN_HUMAN480-529501A:461-51050
1.13ENST0000030819213ENSE00002175196chr6:161155027-16115512094PLMN_HUMAN530-561321A:511-54232
1.14ENST0000030819214ENSE00002152595chr6:161157919-161158039121PLMN_HUMAN561-601411A:542-58241
1.15bENST0000030819215bENSE00002177616chr6:161159570-16115964475PLMN_HUMAN601-626261A:582-60726
1.16ENST0000030819216ENSE00002172545chr6:161160100-161160240141PLMN_HUMAN626-673481A:607-65448
1.17bENST0000030819217bENSE00002178747chr6:161162343-161162449107PLMN_HUMAN673-709371A:654-69037
1.18bENST0000030819218bENSE00002181703chr6:161173147-161173292146PLMN_HUMAN709-757491A:690-73849
1.19bENST0000030819219bENSE00001864790chr6:161173932-161174338407PLMN_HUMAN758-810531A:739-79153

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:682
 aligned with PLMN_HUMAN | P00747 from UniProtKB/Swiss-Prot  Length:810

    Alignment length:789
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801         
           PLMN_HUMAN    22 LDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN 810
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..ee....eeeee..hhhhhhhhhhhh......eeee.....eeeee........ee.....eeeeehhhhh.............................................................eee.......eee.....................................................................ee.......ee...................------------------------------------------------------------------------------------------............ee.........................................................eee.......eee...ee...-----------------....................................................................eee.......eee..............................ee........eeeee.....eeeeeee....eeee..............eeee............eeeeeeeeee.......eeeee.........................eeeeeee.............eeeeeeeehhhhhh............eeee................eeeeee..eeeeeeee............eeeeehhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------E-------R----------K---------------------------------------------------------------------------QK------------P---------------------------------------------------------------------------------------H-------------------------H----------------------------------------------------------------------------------------------------------------F---------------------------------W--------------------------------------------I----------------------------------------V----------------------------W--------H----------------------------------------------------------P----------------------------T-------------------------------------------------------D--------------------------------------------------------------------------R----------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------------------------------------------------------------------------KRINGLE_2  PDB: A:83-162 UniProt: 102-181                                       --KRINGLE_2  PDB: A:165-243 UniProt: 184-262                                     -----------KRINGLE_2  PDB: A:255-255 UniProt: 274-352                                     -----------------------KRINGLE_2  PDB: A:357-435 UniProt: 376-454                                     -------------------------KRINGLE_2  PDB: A:461-541 UniProt: 480-560                                       --------------------TRYPSIN_DOM  PDB: A:562-789 UniProt: 581-808                                                                                                                                                                                        -- PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------KRINGLE_1     --------------------------------------------------------------------KRINGLE_1    -----------------------------------------------------------------------------KRINGLE_1    -----------------------------------------------------------------------------------------KRINGLE_1    --------------------------------------------------------------------------------------------KRINGLE_1     --------------------------------------------------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER --------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2d  PDB: A:3-43 UniProt: 17-62    -----------------------------------Exon 1.4a  PDB: A:79-117               ----------------------------------------------Exon 1.6  PDB: A:164-204 UniProt: 183-223---------------------------------------Exon 1.8  PDB: A:244-255 UniProt: 263-317 [INCOMPLETE] ------------------------------------------------Exon 1.10  PDB: A:347-400 UniProt: 366-419            ------------------------------------------------------------Exon 1.12b  PDB: A:461-510 UniProt: 480-529       Exon 1.13  PDB: A:511-542       ---------------------------------------Exon 1.15b  PDB: A:582-607----------------------------------------------Exon 1.17b  PDB: A:654-690           ------------------------------------------------Exon 1.19b  PDB: A:739-791 UniProt: 758-810           Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------Exon 1.3a  PDB: A:43-79              -------------------------------------Exon 1.5b  PDB: A:117-164 UniProt: 136-183      ---------------------------------------Exon 1.7  PDB: A:204-244 UniProt: 223-263-----------------------------------------------------Exon 1.9  PDB: A:346-347 UniProt: 317-366         ----------------------------------------------------Exon 1.11c  PDB: A:400-461 (gaps) UniProt: 419-480            --------------------------------------------------------------------------------Exon 1.14  PDB: A:542-582                ------------------------Exon 1.16  PDB: A:607-654 UniProt: 626-673      -----------------------------------Exon 1.18b  PDB: A:690-738 UniProt: 709-757      ----------------------------------------------------- Transcript 1 (2)
                 4duu A   3 LDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQ------------------------------------------------------------------------------------------TAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSG-----------------ETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN 791
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252  |      -         -         -         -         -         -         -         -         -   |   352       362       372       382       392       402       412       422       432    |    -         -  |    462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672       682       692       702       712       722       732       742       752       762       772       782         
                                                                                                                                                                                                                                                                                      255                                                                                        346                                                                                        437               455                                                                                                                                                                                                                                                                                                                                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4DUU)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4DUU)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4DUU)

(-) Gene Ontology  (30, 30)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (PLMN_HUMAN | P00747)
molecular function
    GO:0034185    apolipoprotein binding    Interacting selectively and non-covalently with an apolipoprotein, the protein component of a lipoprotein complex.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019904    protein domain specific binding    Interacting selectively and non-covalently with a specific domain of a protein.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0022617    extracellular matrix disassembly    A process that results in the breakdown of the extracellular matrix.
    GO:0042730    fibrinolysis    A process that solubilizes fibrin in the bloodstream of a multicellular organism, chiefly by the proteolytic action of plasmin.
    GO:0007599    hemostasis    The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:2000048    negative regulation of cell-cell adhesion mediated by cadherin    Any process that stops, prevents, or reduces the frequency, rate or extent of cell-cell adhesion mediated by cadherin.
    GO:0010812    negative regulation of cell-substrate adhesion    Any process that decreases the frequency, rate or extent of cell-substrate adhesion. Cell-substrate adhesion is the attachment of a cell to the underlying substrate via adhesion molecules.
    GO:0051918    negative regulation of fibrinolysis    Any process that stops, prevents, or reduces the frequency, rate or extent of fibrinolysis, an ongoing process that solubilizes fibrin, resulting in the removal of small blood clots.
    GO:0002576    platelet degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
    GO:0051919    positive regulation of fibrinolysis    Any process that activates, maintains or increases the frequency, rate or extent of fibrinolysis, an ongoing process that solubilizes fibrin, resulting in the removal of small blood clots.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0048771    tissue remodeling    The reorganization or renovation of existing tissues. This process can either change the characteristics of a tissue such as in blood vessel remodeling, or result in the dynamic equilibrium of a tissue such as in bone remodeling.
cellular component
    GO:0072562    blood microparticle    A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0031232    extrinsic component of external side of plasma membrane    The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its external surface, but not integrated into the hydrophobic region.
    GO:0044218    other organism cell membrane    The cell membrane of a secondary organism with which the first organism is interacting.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0031093    platelet alpha granule lumen    The volume enclosed by the membrane of the platelet alpha granule.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4duu)
 
  Sites
(no "Sites" information available for 4duu)
 
  Cis Peptide Bonds
    Glu A:490 - Pro A:491   [ RasMol ]  
    Ser A:112 - Pro A:113   [ RasMol ]  
    Ser A:194 - Pro A:195   [ RasMol ]  
    Thr A:386 - Pro A:387   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4duu
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PLMN_HUMAN | P00747
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.7
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  217090
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PLMN_HUMAN | P00747
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PLMN_HUMAN | P007471b2i 1bml 1bui 1cea 1ceb 1ddj 1hpj 1hpk 1i5k 1ki0 1krn 1l4d 1l4z 1pk4 1pkr 1pmk 1qrz 1rjx 2doh 2doi 2knf 2l0s 2pk4 3uir 4a5t 4cik 4dcb 4dur 5hpg 5ugd 5ugg

(-) Related Entries Specified in the PDB File

4dur GLYCOFORM