Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MICROPLASMINOGEN-STREPTOKINASE ALPHA DOMAIN COMPLEX
 
Authors :  N. Wakeham, S. Terzyan, P. Zhai, J. A. Loy, J. Tang, X. C. Zhang
Date :  04 Mar 02  (Deposition) - 11 Dec 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  A,B  (2x)
Biol. Unit 3:  A (1x),B (1x)
Keywords :  Streptokinase, Plasminogen, Protein Complex, Crystal Structure, Hydrolase/Hydrolase Activator Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. Wakeham, S. Terzyan, P. Zhai, J. A. Loy, J. Tang, X. C. Zhang
Effects Of Deletion Of Streptokinase Residues 48-59 On Plasminogen Activation
Protein Eng. V. 15 753 2002
PubMed-ID: 12456874  |  Reference-DOI: 10.1093/PROTEIN/15.9.753
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PLASMINOGEN
    ChainsA
    EC Number3.4.21.7
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System PlasmidPET11
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    FragmentCATALYTIC DOMAIN, RESIDUES 543-791
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
 
Molecule 2 - STREPTOKINASE
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System PlasmidPET11
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    FragmentALPHA DOMAIN, RESIDUES 14-147
    Organism ScientificSTREPTOCOCCUS DYSGALACTIAE SUBSP. EQUISIMILIS
    Organism Taxid119602
    StrainSUBSP. EQUISIMILIS

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)AB
Biological Unit 2 (2x)AB
Biological Unit 3 (1x)A (1x)B (1x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1SO42Ligand/IonSULFATE ION
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1SO42Ligand/IonSULFATE ION
Biological Unit 2 (1, 4)
No.NameCountTypeFull Name
1SO44Ligand/IonSULFATE ION
Biological Unit 3 (1, 2)
No.NameCountTypeFull Name
1SO42Ligand/IonSULFATE ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:644 , GLN A:721 , SER A:722BINDING SITE FOR RESIDUE SO4 A 215
2AC2SOFTWAREHOH A:170 , PRO A:768 , ASN A:769 , LYS A:770 , THR B:29 , ASN B:30 , ARG B:45 , HOH B:162BINDING SITE FOR RESIDUE SO4 A 216

(-) SS Bonds  (6, 6)

Asymmetric Unit
No.Residues
1A:548 -A:666
2A:558 -A:566
3A:588 -A:604
4A:680 -A:747
5A:710 -A:726
6A:737 -A:765

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Gln B:130 -Pro B:131

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (4, 4)

Asymmetric Unit (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_006628S591PPLMN_HUMANDisease (PLGD)121918029AS572P
2UniProtVAR_006629A620TPLMN_HUMANDisease (PLGD)121918027AA601T
3UniProtVAR_031213V676DPLMN_HUMANPolymorphism17857492AV657D
4UniProtVAR_006630G751RPLMN_HUMANDisease (PLGD)121918033AG732R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_006628S591PPLMN_HUMANDisease (PLGD)121918029AS572P
2UniProtVAR_006629A620TPLMN_HUMANDisease (PLGD)121918027AA601T
3UniProtVAR_031213V676DPLMN_HUMANPolymorphism17857492AV657D
4UniProtVAR_006630G751RPLMN_HUMANDisease (PLGD)121918033AG732R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (4, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_006628S591PPLMN_HUMANDisease (PLGD)121918029AS572P
2UniProtVAR_006629A620TPLMN_HUMANDisease (PLGD)121918027AA601T
3UniProtVAR_031213V676DPLMN_HUMANPolymorphism17857492AV657D
4UniProtVAR_006630G751RPLMN_HUMANDisease (PLGD)121918033AG732R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_006628S591PPLMN_HUMANDisease (PLGD)121918029AS572P
2UniProtVAR_006629A620TPLMN_HUMANDisease (PLGD)121918027AA601T
3UniProtVAR_031213V676DPLMN_HUMANPolymorphism17857492AV657D
4UniProtVAR_006630G751RPLMN_HUMANDisease (PLGD)121918033AG732R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 3)

Asymmetric Unit (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.PLMN_HUMAN581-808  1A:562-789
2TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.PLMN_HUMAN618-623  1A:599-604
3TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.PLMN_HUMAN754-765  1A:735-746
Biological Unit 1 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.PLMN_HUMAN581-808  1A:562-789
2TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.PLMN_HUMAN618-623  1A:599-604
3TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.PLMN_HUMAN754-765  1A:735-746
Biological Unit 2 (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.PLMN_HUMAN581-808  2A:562-789
2TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.PLMN_HUMAN618-623  2A:599-604
3TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.PLMN_HUMAN754-765  2A:735-746
Biological Unit 3 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.PLMN_HUMAN581-808  1A:562-789
2TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.PLMN_HUMAN618-623  1A:599-604
3TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.PLMN_HUMAN754-765  1A:735-746

(-) Exons   (6, 6)

Asymmetric Unit (6, 6)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000003081921bENSE00001900502chr6:161123274-161123385112PLMN_HUMAN1-17170--
1.2dENST000003081922dENSE00002186994chr6:161127439-161127574136PLMN_HUMAN17-62460--
1.3aENST000003081923aENSE00002162767chr6:161128732-161128838107PLMN_HUMAN62-98370--
1.4aENST000003081924aENSE00002147931chr6:161132109-161132223115PLMN_HUMAN98-136390--
1.5bENST000003081925bENSE00002160428chr6:161134018-161134157140PLMN_HUMAN136-183480--
1.6ENST000003081926ENSE00002153394chr6:161135826-161135946121PLMN_HUMAN183-223410--
1.7ENST000003081927ENSE00002185478chr6:161137677-161137795119PLMN_HUMAN223-263410--
1.8ENST000003081928ENSE00002162125chr6:161139326-161139488163PLMN_HUMAN263-317550--
1.9ENST000003081929ENSE00002174772chr6:161139725-161139870146PLMN_HUMAN317-366500--
1.10ENST0000030819210ENSE00002171287chr6:161143440-161143599160PLMN_HUMAN366-419540--
1.11cENST0000030819211cENSE00002163078chr6:161152083-161152264182PLMN_HUMAN419-480620--
1.12bENST0000030819212bENSE00002160674chr6:161152777-161152925149PLMN_HUMAN480-529500--
1.13ENST0000030819213ENSE00002175196chr6:161155027-16115512094PLMN_HUMAN530-561320--
1.14ENST0000030819214ENSE00002152595chr6:161157919-161158039121PLMN_HUMAN561-601411A:543-58240
1.15bENST0000030819215bENSE00002177616chr6:161159570-16115964475PLMN_HUMAN601-626261A:582-60726
1.16ENST0000030819216ENSE00002172545chr6:161160100-161160240141PLMN_HUMAN626-673481A:607-65448
1.17bENST0000030819217bENSE00002178747chr6:161162343-161162449107PLMN_HUMAN673-709371A:654-69037
1.18bENST0000030819218bENSE00002181703chr6:161173147-161173292146PLMN_HUMAN709-757491A:690-73849
1.19bENST0000030819219bENSE00001864790chr6:161173932-161174338407PLMN_HUMAN758-810531A:739-79153

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:249
 aligned with PLMN_HUMAN | P00747 from UniProtKB/Swiss-Prot  Length:810

    Alignment length:249
                                   571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801         
           PLMN_HUMAN   562 APSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN 810
               SCOP domains d1l4da_ A: Plasmin(ogen), catalytic domain                                                                                                                                                                                                                SCOP domains
               CATH domains -------------------1l4dA01     1l4dA02 A:574-664,A:779-790 Trypsin-like serine proteases                                  1l4dA01 A:562-573,A:665-778 Trypsin-like serine proteases                                                         1l4dA02     - CATH domains
               Pfam domains -------------------Trypsin-1l4dA01 A:562-784                                                                                                                                                                                                      ------- Pfam domains
         Sec.struct. author .......................ee........eeeeee....eeeeeeeee..eeeee.hhhhh..hhh.eeeee............eeeeeeeeee......eeeeee..........................eeeeee.............eeeeeeeehhhhhh............eeee................eeeeee..eeeeeeee............eeeee...hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -----------------------------P----------------------------T-------------------------------------------------------D--------------------------------------------------------------------------R----------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------------------TRYPSIN_DOM  PDB: A:562-789 UniProt: 581-808                                                                                                                                                                                        -- PROSITE (1)
                PROSITE (2) --------------------------------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER --------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.14  PDB: A:543-582 [INCOMPLETE]  ------------------------Exon 1.16  PDB: A:607-654 UniProt: 626-673      -----------------------------------Exon 1.18b  PDB: A:690-738 UniProt: 709-757      Exon 1.19b  PDB: A:739-791 UniProt: 758-810           Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------Exon 1.15b  PDB: A:582-607----------------------------------------------Exon 1.17b  PDB: A:654-690           ----------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1l4d A 543 APSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDAGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN 791
                                   552       562       572       582       592       602       612       622       632       642       652       662       672       682       692       702       712       722       732       742       752       762       772       782         

Chain B from PDB  Type:PROTEIN  Length:112
 aligned with STRP_STREQ | P00779 from UniProtKB/Swiss-Prot  Length:440

    Alignment length:134
                                    49        59        69        79        89        99       109       119       129       139       149       159       169    
           STRP_STREQ    40 NNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPAHGGKTEQGLSPKSKPFATDSGAMSHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYK 173
               SCOP domains d1l4db_ B: Streptokinase                                                                                                               SCOP domains
               CATH domains 1l4dB00 B:14-147  [code=3.10.20.1                      80, no name defined]                                                            CATH domains
               Pfam domains --------Staphylokinase-1l4dB01 B:                      22-146                                                                        - Pfam domains
         Sec.struct. author ...eeeeeeeeee.....ee....eeeeee...----------------------.ee.eeehhhhhhhhhhhhhhh.......eeeeee....eeee....ee......eee.......eeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1l4d B  14 NNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRP----------------------AMPHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYK 147
                                    23        33        43  |      -         -     |  73        83        93       103       113       123       133       143    
                                                           46                     69                                                                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric Unit

(-) CATH Domains  (2, 3)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (2, 2)

Asymmetric Unit

(-) Gene Ontology  (32, 34)

Asymmetric Unit(hide GO term definitions)
Chain A   (PLMN_HUMAN | P00747)
molecular function
    GO:0034185    apolipoprotein binding    Interacting selectively and non-covalently with an apolipoprotein, the protein component of a lipoprotein complex.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019904    protein domain specific binding    Interacting selectively and non-covalently with a specific domain of a protein.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0022617    extracellular matrix disassembly    A process that results in the breakdown of the extracellular matrix.
    GO:0042730    fibrinolysis    A process that solubilizes fibrin in the bloodstream of a multicellular organism, chiefly by the proteolytic action of plasmin.
    GO:0007599    hemostasis    The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:2000048    negative regulation of cell-cell adhesion mediated by cadherin    Any process that stops, prevents, or reduces the frequency, rate or extent of cell-cell adhesion mediated by cadherin.
    GO:0010812    negative regulation of cell-substrate adhesion    Any process that decreases the frequency, rate or extent of cell-substrate adhesion. Cell-substrate adhesion is the attachment of a cell to the underlying substrate via adhesion molecules.
    GO:0051918    negative regulation of fibrinolysis    Any process that stops, prevents, or reduces the frequency, rate or extent of fibrinolysis, an ongoing process that solubilizes fibrin, resulting in the removal of small blood clots.
    GO:0002576    platelet degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
    GO:0051919    positive regulation of fibrinolysis    Any process that activates, maintains or increases the frequency, rate or extent of fibrinolysis, an ongoing process that solubilizes fibrin, resulting in the removal of small blood clots.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0048771    tissue remodeling    The reorganization or renovation of existing tissues. This process can either change the characteristics of a tissue such as in blood vessel remodeling, or result in the dynamic equilibrium of a tissue such as in bone remodeling.
cellular component
    GO:0072562    blood microparticle    A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0031232    extrinsic component of external side of plasma membrane    The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its external surface, but not integrated into the hydrophobic region.
    GO:0044218    other organism cell membrane    The cell membrane of a secondary organism with which the first organism is interacting.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0031093    platelet alpha granule lumen    The volume enclosed by the membrane of the platelet alpha granule.

Chain B   (STRP_STREQ | P00779)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
    GO:0031639    plasminogen activation    The process in which inactive plasminogen is processed to active plasmin. This process includes cleavage at an internal Arg-Val site to form an N-terminal A-chain and C-terminal B-chain held together by a disulfide bond, and can include further proteolytic cleavage events to remove the preactivation peptide.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gln B:130 - Pro B:131   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1l4d
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PLMN_HUMAN | P00747
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  STRP_STREQ | P00779
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.7
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  217090
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PLMN_HUMAN | P00747
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  STRP_STREQ | P00779
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PLMN_HUMAN | P007471b2i 1bml 1bui 1cea 1ceb 1ddj 1hpj 1hpk 1i5k 1ki0 1krn 1l4z 1pk4 1pkr 1pmk 1qrz 1rjx 2doh 2doi 2knf 2l0s 2pk4 3uir 4a5t 4cik 4dcb 4dur 4duu 5hpg 5ugd 5ugg
        STRP_STREQ | P007791bml 1l4z 1qqr

(-) Related Entries Specified in the PDB File

1bml COMPLEX OF THE CATALYTIC DOMAIN OF HUMAN PLASMIN AND STREPTOKINASE
1bui STRUCTURE OF THE TERNARY MICROPLASMIN-STAPHYLOKINASE- MICROPLASMIN COMPLEX: A PROTEINASE-COFACTOR-SUBSTRATE COMPLEX IN ACTION
1ddj CRYSTAL STRUCTURE OF HUMAN PLASMINOGEN CATALYTIC DOMAIN
1qrz CATALYTIC DOMAIN OF PLASMINOGEN