Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  PLASMINOGEN KRINGLE 1 IN COMPLEX WITH INHIBITOR
 
Authors :  Y. Xue, C. Johansson, L. Cheng, D. Pettersen, D. Gustafsson
Date :  10 Dec 13  (Deposition) - 18 Jun 14  (Release) - 18 Jun 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.78
Chains :  Asym./Biol. Unit :  A
Keywords :  Hydrolase, Fibrinolysis, Plasminogen, Protein-Protein Interaction, Kringle Ligand (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Cheng, D. Pettersen, B. Ohlsson, P. Schell, M. Karle, E. Evertsson, S. Pahlen, M. Jonforsen, A. T. Plowright, J. Bostrom, T. Fex, A. Thelin C. Hilgendorf, Y. Xue, G. Wahlund, W. Lindberg, L. Larsson, D. Gustafsson
Discovery Of The Fibrinolysis Inhibitor Azd6564, Acting Via Interference Of A Protein-Protein Interaction.
Acs Med. Chem. Lett. V. 5 538 2014
PubMed-ID: 24900876  |  Reference-DOI: 10.1021/ML400526D

(-) Compounds

Molecule 1 - PLASMINOGEN
    ChainsA
    EC Number3.4.21.7
    EngineeredYES
    Expression SystemKOMAGATAELLA PASTORIS
    Expression System Taxid4922
    FragmentKRINGLE 1, RESIDUES 101-181
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1XO31Ligand/Ion5-[(2R,4S)-2-(PHENYLMETHYL)PIPERIDIN-4-YL]-1,2-OXAZOL-3-ONE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:35 , ASP A:55 , ASP A:57 , TRP A:62 , TYR A:64 , ARG A:71 , TYR A:72BINDING SITE FOR RESIDUE XO3 A1081

(-) SS Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1A:2 -A:80
2A:23 -A:63
3A:51 -A:75

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Ser A:30 -Pro A:31

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (3, 3)

Asymmetric/Biological Unit (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_016288H133QPLMN_HUMANPolymorphism4252186AH32Q
2UniProtVAR_033653R134KPLMN_HUMANPolymorphism2817AR33K
3UniProtVAR_018658L147PPLMN_HUMANDisease (PLGD)770198253AL46P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 2)

Asymmetric/Biological Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1KRINGLE_2PS50070 Kringle domain profile.PLMN_HUMAN102-181
184-262
274-352
376-454
480-560
  1A:1-80
-
-
-
-
2KRINGLE_1PS00021 Kringle domain signature.PLMN_HUMAN151-164
233-245
323-335
425-437
530-543
  1A:50-63
-
-
-
-

(-) Exons   (2, 2)

Asymmetric/Biological Unit (2, 2)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000003081921bENSE00001900502chr6:161123274-161123385112PLMN_HUMAN1-17170--
1.2dENST000003081922dENSE00002186994chr6:161127439-161127574136PLMN_HUMAN17-62460--
1.3aENST000003081923aENSE00002162767chr6:161128732-161128838107PLMN_HUMAN62-98370--
1.4aENST000003081924aENSE00002147931chr6:161132109-161132223115PLMN_HUMAN98-136391A:0-3536
1.5bENST000003081925bENSE00002160428chr6:161134018-161134157140PLMN_HUMAN136-183481A:35-8046
1.6ENST000003081926ENSE00002153394chr6:161135826-161135946121PLMN_HUMAN183-223410--
1.7ENST000003081927ENSE00002185478chr6:161137677-161137795119PLMN_HUMAN223-263410--
1.8ENST000003081928ENSE00002162125chr6:161139326-161139488163PLMN_HUMAN263-317550--
1.9ENST000003081929ENSE00002174772chr6:161139725-161139870146PLMN_HUMAN317-366500--
1.10ENST0000030819210ENSE00002171287chr6:161143440-161143599160PLMN_HUMAN366-419540--
1.11cENST0000030819211cENSE00002163078chr6:161152083-161152264182PLMN_HUMAN419-480620--
1.12bENST0000030819212bENSE00002160674chr6:161152777-161152925149PLMN_HUMAN480-529500--
1.13ENST0000030819213ENSE00002175196chr6:161155027-16115512094PLMN_HUMAN530-561320--
1.14ENST0000030819214ENSE00002152595chr6:161157919-161158039121PLMN_HUMAN561-601410--
1.15bENST0000030819215bENSE00002177616chr6:161159570-16115964475PLMN_HUMAN601-626260--
1.16ENST0000030819216ENSE00002172545chr6:161160100-161160240141PLMN_HUMAN626-673480--
1.17bENST0000030819217bENSE00002178747chr6:161162343-161162449107PLMN_HUMAN673-709370--
1.18bENST0000030819218bENSE00002181703chr6:161173147-161173292146PLMN_HUMAN709-757490--
1.19bENST0000030819219bENSE00001864790chr6:161173932-161174338407PLMN_HUMAN758-810530--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:81
 aligned with PLMN_HUMAN | P00747 from UniProtKB/Swiss-Prot  Length:810

    Alignment length:81
                                   110       120       130       140       150       160       170       180 
           PLMN_HUMAN   101 SECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILEC 181
               SCOP domains --------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............................................................eee.......eee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------QK------------P---------------------------------- SAPs(SNPs)
                PROSITE (1) -KRINGLE_2  PDB: A:1-80 UniProt: 102-181                                          PROSITE (1)
                PROSITE (2) --------------------------------------------------KRINGLE_1     ----------------- PROSITE (2)
           Transcript 1 (1) Exon 1.4a  PDB: A:0-35 [INCOMPLETE] --------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------Exon 1.5b  PDB: A:35-80 UniProt: 136-183       Transcript 1 (2)
                 4cik A   0 SECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILEC  80
                                     9        19        29        39        49        59        69        79 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4CIK)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4CIK)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4CIK)

(-) Gene Ontology  (30, 30)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (PLMN_HUMAN | P00747)
molecular function
    GO:0034185    apolipoprotein binding    Interacting selectively and non-covalently with an apolipoprotein, the protein component of a lipoprotein complex.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019904    protein domain specific binding    Interacting selectively and non-covalently with a specific domain of a protein.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0022617    extracellular matrix disassembly    A process that results in the breakdown of the extracellular matrix.
    GO:0042730    fibrinolysis    A process that solubilizes fibrin in the bloodstream of a multicellular organism, chiefly by the proteolytic action of plasmin.
    GO:0007599    hemostasis    The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:2000048    negative regulation of cell-cell adhesion mediated by cadherin    Any process that stops, prevents, or reduces the frequency, rate or extent of cell-cell adhesion mediated by cadherin.
    GO:0010812    negative regulation of cell-substrate adhesion    Any process that decreases the frequency, rate or extent of cell-substrate adhesion. Cell-substrate adhesion is the attachment of a cell to the underlying substrate via adhesion molecules.
    GO:0051918    negative regulation of fibrinolysis    Any process that stops, prevents, or reduces the frequency, rate or extent of fibrinolysis, an ongoing process that solubilizes fibrin, resulting in the removal of small blood clots.
    GO:0002576    platelet degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
    GO:0051919    positive regulation of fibrinolysis    Any process that activates, maintains or increases the frequency, rate or extent of fibrinolysis, an ongoing process that solubilizes fibrin, resulting in the removal of small blood clots.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0048771    tissue remodeling    The reorganization or renovation of existing tissues. This process can either change the characteristics of a tissue such as in blood vessel remodeling, or result in the dynamic equilibrium of a tissue such as in bone remodeling.
cellular component
    GO:0072562    blood microparticle    A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0031232    extrinsic component of external side of plasma membrane    The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its external surface, but not integrated into the hydrophobic region.
    GO:0044218    other organism cell membrane    The cell membrane of a secondary organism with which the first organism is interacting.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0031093    platelet alpha granule lumen    The volume enclosed by the membrane of the platelet alpha granule.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    XO3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ser A:30 - Pro A:31   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4cik
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PLMN_HUMAN | P00747
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.7
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  217090
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PLMN_HUMAN | P00747
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PLMN_HUMAN | P007471b2i 1bml 1bui 1cea 1ceb 1ddj 1hpj 1hpk 1i5k 1ki0 1krn 1l4d 1l4z 1pk4 1pkr 1pmk 1qrz 1rjx 2doh 2doi 2knf 2l0s 2pk4 3uir 4a5t 4dcb 4dur 4duu 5hpg 5ugd 5ugg

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4CIK)