Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF 53BP1 TANDEM TUDOR DOMAINS IN COMPLEX WITH METHYLATED K810 RB PEPTIDE
 
Authors :  T. Krojer, C. Johansson, C. Gileadi, O. Fedorov, S. Carr, N. B. La Thang M. Vollmar, L. Crawley, F. Von Delft, C. Bountra, C. H. Arrowsmith, A. U. Oppermann
Date :  26 Feb 14  (Deposition) - 06 Aug 14  (Release) - 20 Aug 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.35
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Peptide Binding Protein, Tumour Suppressor Prb, 53Bp1 (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. M. Carr, S. Munro, L. Zalmas, O. Fedorov, C. Johansson, T. Krojer, C. A. Sagum, M. T. Bedford, U. Oppermann, N. B. La Thangue
Lysine Methylation-Dependent Binding Of 53Bp1 To The Prb Tumor Suppressor.
Proc. Natl. Acad. Sci. Usa V. 111 11341 2014
PubMed-ID: 25049398  |  Reference-DOI: 10.1073/PNAS.1403737111

(-) Compounds

Molecule 1 - TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentTANDEM TUDOR DOMAIN, RESIDUES 1459-1634
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Synonym53BP1,P53-BINDING PROTEIN 1,P53BP1,53BP1
 
Molecule 2 - RB1 PROTEIN
    ChainsC, D
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymRBK810ME2 PEPTIDE
    SyntheticYES

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1MLY2Mod. Amino AcidN-DIMETHYL-LYSINE

(-) Sites  (0, 0)

(no "Site" information available for 4CRI)

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:1525 -B:1525

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Asp A:1536 -Pro A:1537
2Asp B:1536 -Pro B:1537

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 2)

Asymmetric/Biological Unit (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_038689G1488WTP53B_HUMANPolymorphism11554564A/BG1488W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4CRI)

(-) Exons   (3, 6)

Asymmetric/Biological Unit (3, 6)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000002638011bENSE00001344404chr15:43802812-43802568245TP53B_HUMAN-00--
1.4ENST000002638014ENSE00001713374chr15:43784666-43784482185TP53B_HUMAN1-59590--
1.5ENST000002638015ENSE00001046179chr15:43784293-4378420094TP53B_HUMAN60-91320--
1.6ENST000002638016ENSE00001046160chr15:43783951-4378386785TP53B_HUMAN91-119290--
1.7ENST000002638017ENSE00001046169chr15:43773220-43773093128TP53B_HUMAN119-162440--
1.8ENST000002638018ENSE00001046152chr15:43772215-43772057159TP53B_HUMAN162-215540--
1.9ENST000002638019ENSE00001046208chr15:43771724-43771595130TP53B_HUMAN215-258440--
1.10ENST0000026380110ENSE00001046166chr15:43769957-43769791167TP53B_HUMAN258-314570--
1.11ENST0000026380111ENSE00001046193chr15:43767892-43767763130TP53B_HUMAN314-357440--
1.12ENST0000026380112ENSE00001046180chr15:43766965-4376687195TP53B_HUMAN357-389330--
1.13ENST0000026380113ENSE00001046161chr15:43762264-43762056209TP53B_HUMAN389-458700--
1.14aENST0000026380114aENSE00001046204chr15:43749416-437480901327TP53B_HUMAN459-9014430--
1.15aENST0000026380115aENSE00001046164chr15:43739683-43739564120TP53B_HUMAN901-941410--
1.17ENST0000026380117ENSE00001628086chr15:43738788-43738585204TP53B_HUMAN941-1009690--
1.18aENST0000026380118aENSE00001675565chr15:43733781-4373372458TP53B_HUMAN1009-1028200--
1.19aENST0000026380119aENSE00001595850chr15:43730614-4373052293TP53B_HUMAN1028-1059320--
1.20bENST0000026380120bENSE00001729133chr15:43724875-43724392484TP53B_HUMAN1059-12201620--
1.21aENST0000026380121aENSE00001648704chr15:43720366-43720214153TP53B_HUMAN1221-1271510--
1.22aENST0000026380122aENSE00001612038chr15:43714324-43714053272TP53B_HUMAN1272-1362910--
1.23bENST0000026380123bENSE00001657667chr15:43713372-43713223150TP53B_HUMAN1362-1412510--
1.24aENST0000026380124aENSE00001735071chr15:43712933-43712503431TP53B_HUMAN1412-15561452A:1485-1556
B:1485-1556
72
72
1.25bENST0000026380125bENSE00001666968chr15:43708614-43708423192TP53B_HUMAN1556-1620652A:1556-1604
B:1556-1604
49
49
1.26ENST0000026380126ENSE00001684657chr15:43708007-43707792216TP53B_HUMAN1620-1692730--
1.28bENST0000026380128bENSE00001734669chr15:43705532-43705317216TP53B_HUMAN1692-1764730--
1.30ENST0000026380130ENSE00001771292chr15:43701939-4370184595TP53B_HUMAN1764-1795320--
1.31bENST0000026380131bENSE00001727562chr15:43701294-43701095200TP53B_HUMAN1796-1862670--
1.32ENST0000026380132ENSE00001751396chr15:43700286-43700141146TP53B_HUMAN1862-1911500--
1.33bENST0000026380133bENSE00001841464chr15:43699768-43699407362TP53B_HUMAN1911-1972620--

2.1bENST000002671631bENSE00002199946chr13:48877911-48878185275RB_HUMAN1-46460--
2.2ENST000002671632ENSE00000939664chr13:48881416-48881542127RB_HUMAN46-88430--
2.3ENST000002671633ENSE00000939665chr13:48916735-48916850116RB_HUMAN89-127390--
2.4ENST000002671634ENSE00000939666chr13:48919216-48919335120RB_HUMAN127-167410--
2.5ENST000002671635ENSE00000939667chr13:48921961-4892199939RB_HUMAN167-180140--
2.6ENST000002671636ENSE00000939668chr13:48923092-4892315968RB_HUMAN180-203240--
2.7aENST000002671637aENSE00000939669chr13:48934153-48934263111RB_HUMAN203-240380--
2.8bENST000002671638bENSE00000939670chr13:48936951-48937093143RB_HUMAN240-287480--
2.9ENST000002671639ENSE00000939671chr13:48939030-4893910778RB_HUMAN288-313260--
2.10ENST0000026716310ENSE00000939672chr13:48941630-48941739110RB_HUMAN314-350370--
2.11ENST0000026716311ENSE00000939673chr13:48942663-4894274078RB_HUMAN350-376270--
2.12ENST0000026716312ENSE00000939674chr13:48947541-4894762888RB_HUMAN376-405300--
2.13ENST0000026716313ENSE00000939675chr13:48951054-48951170117RB_HUMAN406-444390--
2.14ENST0000026716314ENSE00000939676chr13:48953730-4895378657RB_HUMAN445-463190--
2.15ENST0000026716315ENSE00000939677chr13:48954189-4895422032RB_HUMAN464-474110--
2.16ENST0000026716316ENSE00000939678chr13:48954301-4895437777RB_HUMAN474-500270--
2.17ENST0000026716317ENSE00000939679chr13:48955383-48955579197RB_HUMAN500-565660--
2.19ENST0000026716319ENSE00000939680chr13:49027129-49027247119RB_HUMAN566-605400--
2.20bENST0000026716320bENSE00000939681chr13:49030340-49030485146RB_HUMAN605-654500--
2.21ENST0000026716321ENSE00000939682chr13:49033824-49033969146RB_HUMAN654-702490--
2.22ENST0000026716322ENSE00000939683chr13:49037867-49037971105RB_HUMAN703-737350--
2.23ENST0000026716323ENSE00000939684chr13:49039134-49039247114RB_HUMAN738-775380--
2.24ENST0000026716324ENSE00000939685chr13:49039341-49039504164RB_HUMAN776-830552C:804-810
D:805-810
7
6
2.25ENST0000026716325ENSE00001003962chr13:49047496-4904752631RB_HUMAN830-840110--
2.26cENST0000026716326cENSE00000939686chr13:49050837-49050979143RB_HUMAN841-888480--
2.27ENST0000026716327ENSE00000939687chr13:49051491-4905154050RB_HUMAN888-905180--
2.28cENST0000026716328cENSE00001241067chr13:49054134-490561221989RB_HUMAN905-928240--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:120
 aligned with TP53B_HUMAN | Q12888 from UniProtKB/Swiss-Prot  Length:1972

    Alignment length:120
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594      1604
         TP53B_HUMAN   1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGP 1604
               SCOP domains ------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeee.......eeeeeeeeeee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---W-------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.24a  PDB: A:1485-1556 UniProt: 1412-1556 [INCOMPLETE]            ------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------Exon 1.25b  PDB: A:1556-1604 UniProt: 1556-1620   Transcript 1 (2)
                4cri A 1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGP 1604
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594      1604

Chain B from PDB  Type:PROTEIN  Length:120
 aligned with TP53B_HUMAN | Q12888 from UniProtKB/Swiss-Prot  Length:1972

    Alignment length:120
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594      1604
         TP53B_HUMAN   1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGP 1604
               SCOP domains ------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eeeee......eeeeeeeeeee..eeeeee....eeeee...ee.........eeee.......eeeeeeeeeee..eeeeeeee..eeeeee...ee.hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---W-------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.24a  PDB: B:1485-1556 UniProt: 1412-1556 [INCOMPLETE]            ------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------Exon 1.25b  PDB: B:1556-1604 UniProt: 1556-1620   Transcript 1 (2)
                4cri B 1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGP 1604
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594      1604

Chain C from PDB  Type:PROTEIN  Length:7
 aligned with P78495_HUMAN | P78495 from UniProtKB/TrEMBL  Length:54

    Alignment length:7
        P78495_HUMAN     29 IYISPLK   35
               SCOP domains ------- SCOP domains
               CATH domains ------- CATH domains
               Pfam domains ------- Pfam domains
         Sec.struct. author ....... Sec.struct. author
                 SAPs(SNPs) ------- SAPs(SNPs)
                    PROSITE ------- PROSITE
                 Transcript ------- Transcript
                4cri C  804 IYISPLk  810
                                  |
                                  |
                                810-MLY

Chain C from PDB  Type:PROTEIN  Length:7
 aligned with RB_HUMAN | P06400 from UniProtKB/Swiss-Prot  Length:928

    Alignment length:7
            RB_HUMAN    804 IYISPLK  810
               SCOP domains ------- SCOP domains
               CATH domains ------- CATH domains
               Pfam domains ------- Pfam domains
         Sec.struct. author ....... Sec.struct. author
                 SAPs(SNPs) ------- SAPs(SNPs)
                    PROSITE ------- PROSITE
               Transcript 2 2.24    Transcript 2
                4cri C  804 IYISPLk  810
                                  |
                                  |
                                810-MLY

Chain D from PDB  Type:PROTEIN  Length:6
 aligned with P78495_HUMAN | P78495 from UniProtKB/TrEMBL  Length:54

    Alignment length:6
        P78495_HUMAN     30 YISPLK   35
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                4cri D  805 YISPLk  810
                                 |
                                 |
                               810-MLY

Chain D from PDB  Type:PROTEIN  Length:6
 aligned with RB_HUMAN | P06400 from UniProtKB/Swiss-Prot  Length:928

    Alignment length:6
            RB_HUMAN    805 YISPLK  810
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
               Transcript 2 2.24   Transcript 2
                4cri D  805 YISPLk  810
                                 |
                                 |
                               810-MLY

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4CRI)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4CRI)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4CRI)

(-) Gene Ontology  (92, 109)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (TP53B_HUMAN | Q12888)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0001102    RNA polymerase II activating transcription factor binding    Interacting selectively and non-covalently with an RNA polymerase II transcription activating factor, a protein involved in positive regulation of transcription.
    GO:0001104    RNA polymerase II transcription cofactor activity    Interacting selectively and non-covalently with an RNA polymerase II (RNAP II) regulatory transcription factor and also with the RNAP II basal transcription machinery in order to modulate transcription. Cofactors generally do not bind DNA, but rather mediate protein-protein interactions between regulatory transcription factors and the basal RNAP II transcription machinery.
    GO:0035064    methylated histone binding    Interacting selectively and non-covalently with a histone in which a residue has been modified by methylation. Histones are any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes.
    GO:0002039    p53 binding    Interacting selectively and non-covalently with one of the p53 family of proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0000077    DNA damage checkpoint    A cell cycle checkpoint that regulates progression through the cell cycle in response to DNA damage. A DNA damage checkpoint may blocks cell cycle progression (in G1, G2 or metaphase) or slow the rate at which S phase proceeds.
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0071481    cellular response to X-ray    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of X-ray radiation. An X-ray is a form of electromagnetic radiation with a wavelength in the range of 10 nanometers to 100 picometers (corresponding to frequencies in the range 30 PHz to 3 EHz).
    GO:0006303    double-strand break repair via nonhomologous end joining    The repair of a double-strand break in DNA in which the two broken ends are rejoined with little or no sequence complementarity. Information at the DNA ends may be lost due to the modification of broken DNA ends. This term covers instances of separate pathways, called classical (or canonical) and alternative nonhomologous end joining (C-NHEJ and A-NHEJ). These in turn may further branch into sub-pathways, but evidence is still unclear.
    GO:0051091    positive regulation of sequence-specific DNA binding transcription factor activity    Any process that activates or increases the frequency, rate or extent of activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0016925    protein sumoylation    The process in which a SUMO protein (small ubiquitin-related modifier) is conjugated to a target protein via an isopeptide bond between the carboxyl terminus of SUMO with an epsilon-amino group of a lysine residue of the target protein.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005694    chromosome    A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
    GO:0000775    chromosome, centromeric region    The region of a chromosome that includes the centromeric DNA and associated proteins. In monocentric chromosomes, this region corresponds to a single area of the chromosome, whereas in holocentric chromosomes, it is evenly distributed along the chromosome.
    GO:0000781    chromosome, telomeric region    The terminal region of a linear chromosome that includes the telomeric DNA repeats and associated proteins.
    GO:0000777    condensed chromosome kinetochore    A multisubunit complex that is located at the centromeric region of a condensed chromosome and provides an attachment point for the spindle microtubules.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0000776    kinetochore    A multisubunit complex that is located at the centromeric region of DNA and provides an attachment point for the spindle microtubules.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C,D   (P78495_HUMAN | P78495)
molecular function
    GO:0008134    transcription factor binding    Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
biological process
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:2000134    negative regulation of G1/S transition of mitotic cell cycle    Any cell cycle regulatory process that prevents the commitment of a cell from G1 to S phase of the mitotic cell cycle.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0051726    regulation of cell cycle    Any process that modulates the rate or extent of progression through the cell cycle.
    GO:0006357    regulation of transcription from RNA polymerase II promoter    Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
cellular component
    GO:0035189    Rb-E2F complex    A multiprotein complex containing a heterodimeric E2F transcription factor and a Retinoblastoma (Rb) family member. This complex is capable of repressing transcription of E2F-regulated genes in order to regulate cell cycle progression.

Chain C,D   (RB_HUMAN | P06400)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0001102    RNA polymerase II activating transcription factor binding    Interacting selectively and non-covalently with an RNA polymerase II transcription activating factor, a protein involved in positive regulation of transcription.
    GO:0050681    androgen receptor binding    Interacting selectively and non-covalently with an androgen receptor.
    GO:0001047    core promoter binding    Interacting selectively and non-covalently with the regulatory region composed of the transcription start site and binding sites for the basal transcription machinery. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
    GO:0019899    enzyme binding    Interacting selectively and non-covalently with any enzyme.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0019900    kinase binding    Interacting selectively and non-covalently with a kinase, any enzyme that catalyzes the transfer of a phosphate group.
    GO:0051219    phosphoprotein binding    Interacting selectively and non-covalently with a phosphorylated protein.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003713    transcription coactivator activity    Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0008134    transcription factor binding    Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
    GO:0000082    G1/S transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G1 commits to S phase. The process begins with the build up of G1 cyclin-dependent kinase (G1 CDK), resulting in the activation of transcription of G1 cyclins. The process ends with the positive feedback of the G1 cyclins on the G1 CDK which commits the cell to S phase, in which DNA replication is initiated.
    GO:0007265    Ras protein signal transduction    A series of molecular signals within the cell that are mediated by a member of the Ras superfamily of proteins switching to a GTP-bound active state.
    GO:0030521    androgen receptor signaling pathway    Any series of molecular signals generated as a consequence of an androgen binding to its receptor.
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0007050    cell cycle arrest    A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
    GO:0000075    cell cycle checkpoint    A cell cycle process that controls cell cycle progression by monitoring the integrity of specific cell cycle events. A cell cycle checkpoint begins with detection of deficiencies or defects and ends with signal transduction.
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:0048667    cell morphogenesis involved in neuron differentiation    The process in which the structures of a neuron are generated and organized. This process occurs while the initially relatively unspecialized cell is acquiring the specialized features of a neuron.
    GO:0071466    cellular response to xenobiotic stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a xenobiotic compound stimulus. Xenobiotic compounds are compounds foreign to living organisms.
    GO:0006338    chromatin remodeling    Dynamic structural changes to eukaryotic chromatin occurring throughout the cell division cycle. These changes range from the local changes necessary for transcriptional regulation to global changes necessary for chromosome segregation.
    GO:0048565    digestive tract development    The process whose specific outcome is the progression of the digestive tract over time, from its formation to the mature structure. The digestive tract is the anatomical structure through which food passes and is processed.
    GO:0043353    enucleate erythrocyte differentiation    The process in which a myeloid precursor cell acquires specialized features of an erythrocyte without a nucleus. An example of this process is found in Mus musculus.
    GO:0034349    glial cell apoptotic process    Any apoptotic process in a glial cell, a non-neuronal cell of the nervous system.
    GO:0097284    hepatocyte apoptotic process    Any apoptotic process in a hepatocyte, the main structural component of the liver.
    GO:0034088    maintenance of mitotic sister chromatid cohesion    The process in which the association between sister chromatids of a replicated chromosome is maintained as chromosomes condense, attach to the spindle in a bipolar orientation, and congress to the metaphase plate during a mitotic cell cycle.
    GO:0007093    mitotic cell cycle checkpoint    A cell cycle checkpoint that ensures accurate chromosome replication and segregation by preventing progression through a mitotic cell cycle until conditions are suitable for the cell to proceed to the next stage.
    GO:0045445    myoblast differentiation    The process in which a relatively unspecialized cell acquires specialized features of a myoblast. A myoblast is a mononucleate cell type that, by fusion with other myoblasts, gives rise to the myotubes that eventually develop into striated muscle fibers.
    GO:2000134    negative regulation of G1/S transition of mitotic cell cycle    Any cell cycle regulatory process that prevents the commitment of a cell from G1 to S phase of the mitotic cell cycle.
    GO:0045786    negative regulation of cell cycle    Any process that stops, prevents or reduces the rate or extent of progression through the cell cycle.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:0050680    negative regulation of epithelial cell proliferation    Any process that stops, prevents or reduces the rate or extent of epithelial cell proliferation.
    GO:0010629    negative regulation of gene expression    Any process that decreases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0045930    negative regulation of mitotic cell cycle    Any process that stops, prevents or reduces the rate or extent of progression through the mitotic cell cycle.
    GO:0006469    negative regulation of protein kinase activity    Any process that stops, prevents, or reduces the frequency, rate or extent of protein kinase activity.
    GO:0043433    negative regulation of sequence-specific DNA binding transcription factor activity    Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
    GO:0045879    negative regulation of smoothened signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of smoothened signaling.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0007070    negative regulation of transcription from RNA polymerase II promoter during mitotic cell cycle    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter that occurs during the mitotic cell cycle.
    GO:0071930    negative regulation of transcription involved in G1/S transition of mitotic cell cycle    Any process that stop, prevents or decreases transcription as part of the G1/S transition of the mitotic cell cycle.
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0051402    neuron apoptotic process    Any apoptotic process in a neuron, the basic cellular unit of nervous tissue. Each neuron consists of a body, an axon, and dendrites. Their purpose is to receive, conduct, and transmit impulses in the nervous system.
    GO:0030182    neuron differentiation    The process in which a relatively unspecialized cell acquires specialized features of a neuron.
    GO:0042551    neuron maturation    A developmental process, independent of morphogenetic (shape) change, that is required for a neuron to attain its fully functional state.
    GO:0031175    neuron projection development    The process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
    GO:0045651    positive regulation of macrophage differentiation    Any process that activates or increases the frequency, rate or extent of macrophage differentiation.
    GO:0045842    positive regulation of mitotic metaphase/anaphase transition    Any process that activates or increases the frequency, rate or extent of the cell cycle process in which a cell progresses from metaphase to anaphase during mitosis, triggered by the activation of the anaphase promoting complex by Cdc20/Sleepy homolog which results in the degradation of Securin.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:2000679    positive regulation of transcription regulatory region DNA binding    Any process that activates or increases the frequency, rate or extent of transcription regulatory region DNA binding.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0071459    protein localization to chromosome, centromeric region    Any process in which a protein is transported to, or maintained at, the centromeric region of a chromosome.
    GO:0051726    regulation of cell cycle    Any process that modulates the rate or extent of progression through the cell cycle.
    GO:0090230    regulation of centromere complex assembly    Any process that modulates the rate, frequency, or extent of centromere complex assembly, the aggregation, arrangement and bonding together of proteins and centromeric DNA molecules to form a centromeric protein-DNA complex.
    GO:0071922    regulation of cohesin loading    Any process that modulates the frequency, rate or extent of a process in which a cohesin complex is transported to, or maintained at, a part of a chromosome that is organized into chromatin.
    GO:0043550    regulation of lipid kinase activity    Any process that modulates the frequency, rate or extent of lipid kinase activity, the catalysis of the transfer of a phosphate group, usually from ATP, to a simple or complex lipid.
    GO:0007346    regulation of mitotic cell cycle    Any process that modulates the rate or extent of progress through the mitotic cell cycle.
    GO:0006357    regulation of transcription from RNA polymerase II promoter    Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0000083    regulation of transcription involved in G1/S transition of mitotic cell cycle    Any process that regulates transcription such that the target genes are involved in the transition between G1 and S phase of the mitotic cell cycle.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0031134    sister chromatid biorientation    The cell cycle process in which sister chromatids establish stable attachments to microtubules emanating from opposite spindle poles.
    GO:0035914    skeletal muscle cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of a skeletal muscle cell, a somatic cell located in skeletal muscle.
    GO:0051146    striated muscle cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of a striated muscle cell; striated muscle fibers are divided by transverse bands into striations, and cardiac and voluntary muscle are types of striated muscle.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0016605    PML body    A class of nuclear body; they react against SP100 auto-antibodies (PML, promyelocytic leukemia); cells typically contain 10-30 PML bodies per nucleus; alterations in the localization of PML bodies occurs after viral infection.
    GO:0035189    Rb-E2F complex    A multiprotein complex containing a heterodimeric E2F transcription factor and a Retinoblastoma (Rb) family member. This complex is capable of repressing transcription of E2F-regulated genes in order to regulate cell cycle progression.
    GO:0016514    SWI/SNF complex    A SWI/SNF-type complex that contains nine or more proteins, including both conserved (core) and nonconserved components; the Swi2/Snf2 ATPase is one of the core components.
    GO:0000785    chromatin    The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome.
    GO:0008024    cyclin/CDK positive transcription elongation factor complex    A transcription elongation factor complex that facilitates the transition from abortive to productive elongation by phosphorylating the CTD domain of the large subunit of DNA-directed RNA polymerase II, holoenzyme. Contains a cyclin and a cyclin-dependent protein kinase catalytic subunit.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005819    spindle    The array of microtubules and associated molecules that forms between opposite poles of a eukaryotic cell during mitosis or meiosis and serves to move the duplicated chromosomes apart.
    GO:0005667    transcription factor complex    A protein complex that is capable of associating with DNA by direct binding, or via other DNA-binding proteins or complexes, and regulating transcription.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MLY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 4cri)
 
  Cis Peptide Bonds
    Asp A:1536 - Pro A:1537   [ RasMol ]  
    Asp B:1536 - Pro B:1537   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4cri
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  P78495_HUMAN | P78495
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RB_HUMAN | P06400
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  TP53B_HUMAN | Q12888
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  P78495_HUMAN | P78495
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RB_HUMAN | P06400
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TP53B_HUMAN | Q12888
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RB_HUMAN | P064001ad6 1gh6 1gux 1h25 1n4m 1o9k 1pjm 2aze 2qdj 2r7g 3n5u 3pom 4elj 4ell
        TP53B_HUMAN | Q128881gzh 1kzy 1xni 2g3r 2ig0 2lvm 2mwo 2mwp 3lgf 3lgl 3lh0 4rg2 4x34 5ecg 5j26 5kgf

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4CRI)