1O9K - JenaLib

Asymmetric Unit (19, 76)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_019379	Q	436	K	RB_HUMAN	Polymorphism	4151534	A/C/E/G	Q	436	K
02	UniProt	VAR_010048	K	447	Q	RB_HUMAN	Disease (RB)	---	A/C/E/G	K	447	Q
03	UniProt	VAR_005576	M	457	R	RB_HUMAN	Disease (RB)	---	A/C/E/G	M	457	R
04	UniProt	VAR_011580	R	500	G	RB_HUMAN	Disease (RB)	---	A/C/E/G	R	500	G
05	UniProt	VAR_019380	A	525	G	RB_HUMAN	Polymorphism	4151539	A/C/E/G	A	525	G
06	UniProt	VAR_010049	K	530	R	RB_HUMAN	Disease (RB)	---	A/C/E/G	K	530	R
07	UniProt	VAR_005578	H	549	Y	RB_HUMAN	Disease (RB)	---	A/C/E/G	H	549	Y
08	UniProt	VAR_005579	S	567	L	RB_HUMAN	Disease (RB)	137853292	A/C/E/G	S	567	L
09	UniProt	VAR_051910	L	569	F	RB_HUMAN	Polymorphism	3092895	A/C/E/G	L	569	F
10	UniProt	VAR_005581	V	654	E	RB_HUMAN	Disease (RB)	---	B/D/F/H	V	654	E
11	UniProt	VAR_010050	L	657	P	RB_HUMAN	Disease (RB)	---	B/D/F/H	L	657	P
12	UniProt	VAR_005582	R	661	W	RB_HUMAN	Disease (RB)	137853294	B/D/F/H	R	661	W
13	UniProt	VAR_005583	L	662	P	RB_HUMAN	Disease (RB)	---	B/D/F/H	L	662	P
14	UniProt	VAR_005584	H	673	P	RB_HUMAN	Disease (RB)	---	B/D/F/H	H	673	P
15	UniProt	VAR_005585	Q	685	P	RB_HUMAN	Disease (RB)	---	B/D/F/H	Q	685	P
16	UniProt	VAR_051911	D	697	E	RB_HUMAN	Polymorphism	3092903	B/D/F/H	D	697	E
17	UniProt	VAR_005586	C	706	Y	RB_HUMAN	Disease (RB)	---	B/D/F/H	C	706	Y
18	UniProt	VAR_005587	C	712	R	RB_HUMAN	Disease (RB)	137853296	B/D/F/H	C	712	R
19	UniProt	VAR_034442	E	746	G	RB_HUMAN	Polymorphism	3092905	B/D/F/H	E	746	G

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (19, 19)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_019379	Q	436	K	RB_HUMAN	Polymorphism	4151534	A	Q	436	K
02	UniProt	VAR_010048	K	447	Q	RB_HUMAN	Disease (RB)	---	A	K	447	Q
03	UniProt	VAR_005576	M	457	R	RB_HUMAN	Disease (RB)	---	A	M	457	R
04	UniProt	VAR_011580	R	500	G	RB_HUMAN	Disease (RB)	---	A	R	500	G
05	UniProt	VAR_019380	A	525	G	RB_HUMAN	Polymorphism	4151539	A	A	525	G
06	UniProt	VAR_010049	K	530	R	RB_HUMAN	Disease (RB)	---	A	K	530	R
07	UniProt	VAR_005578	H	549	Y	RB_HUMAN	Disease (RB)	---	A	H	549	Y
08	UniProt	VAR_005579	S	567	L	RB_HUMAN	Disease (RB)	137853292	A	S	567	L
09	UniProt	VAR_051910	L	569	F	RB_HUMAN	Polymorphism	3092895	A	L	569	F
10	UniProt	VAR_005581	V	654	E	RB_HUMAN	Disease (RB)	---	B	V	654	E
11	UniProt	VAR_010050	L	657	P	RB_HUMAN	Disease (RB)	---	B	L	657	P
12	UniProt	VAR_005582	R	661	W	RB_HUMAN	Disease (RB)	137853294	B	R	661	W
13	UniProt	VAR_005583	L	662	P	RB_HUMAN	Disease (RB)	---	B	L	662	P
14	UniProt	VAR_005584	H	673	P	RB_HUMAN	Disease (RB)	---	B	H	673	P
15	UniProt	VAR_005585	Q	685	P	RB_HUMAN	Disease (RB)	---	B	Q	685	P
16	UniProt	VAR_051911	D	697	E	RB_HUMAN	Polymorphism	3092903	B	D	697	E
17	UniProt	VAR_005586	C	706	Y	RB_HUMAN	Disease (RB)	---	B	C	706	Y
18	UniProt	VAR_005587	C	712	R	RB_HUMAN	Disease (RB)	137853296	B	C	712	R
19	UniProt	VAR_034442	E	746	G	RB_HUMAN	Polymorphism	3092905	B	E	746	G

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (19, 19)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_019379	Q	436	K	RB_HUMAN	Polymorphism	4151534	C	Q	436	K
02	UniProt	VAR_010048	K	447	Q	RB_HUMAN	Disease (RB)	---	C	K	447	Q
03	UniProt	VAR_005576	M	457	R	RB_HUMAN	Disease (RB)	---	C	M	457	R
04	UniProt	VAR_011580	R	500	G	RB_HUMAN	Disease (RB)	---	C	R	500	G
05	UniProt	VAR_019380	A	525	G	RB_HUMAN	Polymorphism	4151539	C	A	525	G
06	UniProt	VAR_010049	K	530	R	RB_HUMAN	Disease (RB)	---	C	K	530	R
07	UniProt	VAR_005578	H	549	Y	RB_HUMAN	Disease (RB)	---	C	H	549	Y
08	UniProt	VAR_005579	S	567	L	RB_HUMAN	Disease (RB)	137853292	C	S	567	L
09	UniProt	VAR_051910	L	569	F	RB_HUMAN	Polymorphism	3092895	C	L	569	F
10	UniProt	VAR_005581	V	654	E	RB_HUMAN	Disease (RB)	---	D	V	654	E
11	UniProt	VAR_010050	L	657	P	RB_HUMAN	Disease (RB)	---	D	L	657	P
12	UniProt	VAR_005582	R	661	W	RB_HUMAN	Disease (RB)	137853294	D	R	661	W
13	UniProt	VAR_005583	L	662	P	RB_HUMAN	Disease (RB)	---	D	L	662	P
14	UniProt	VAR_005584	H	673	P	RB_HUMAN	Disease (RB)	---	D	H	673	P
15	UniProt	VAR_005585	Q	685	P	RB_HUMAN	Disease (RB)	---	D	Q	685	P
16	UniProt	VAR_051911	D	697	E	RB_HUMAN	Polymorphism	3092903	D	D	697	E
17	UniProt	VAR_005586	C	706	Y	RB_HUMAN	Disease (RB)	---	D	C	706	Y
18	UniProt	VAR_005587	C	712	R	RB_HUMAN	Disease (RB)	137853296	D	C	712	R
19	UniProt	VAR_034442	E	746	G	RB_HUMAN	Polymorphism	3092905	D	E	746	G

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (19, 19)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_019379	Q	436	K	RB_HUMAN	Polymorphism	4151534	E	Q	436	K
02	UniProt	VAR_010048	K	447	Q	RB_HUMAN	Disease (RB)	---	E	K	447	Q
03	UniProt	VAR_005576	M	457	R	RB_HUMAN	Disease (RB)	---	E	M	457	R
04	UniProt	VAR_011580	R	500	G	RB_HUMAN	Disease (RB)	---	E	R	500	G
05	UniProt	VAR_019380	A	525	G	RB_HUMAN	Polymorphism	4151539	E	A	525	G
06	UniProt	VAR_010049	K	530	R	RB_HUMAN	Disease (RB)	---	E	K	530	R
07	UniProt	VAR_005578	H	549	Y	RB_HUMAN	Disease (RB)	---	E	H	549	Y
08	UniProt	VAR_005579	S	567	L	RB_HUMAN	Disease (RB)	137853292	E	S	567	L
09	UniProt	VAR_051910	L	569	F	RB_HUMAN	Polymorphism	3092895	E	L	569	F
10	UniProt	VAR_005581	V	654	E	RB_HUMAN	Disease (RB)	---	F	V	654	E
11	UniProt	VAR_010050	L	657	P	RB_HUMAN	Disease (RB)	---	F	L	657	P
12	UniProt	VAR_005582	R	661	W	RB_HUMAN	Disease (RB)	137853294	F	R	661	W
13	UniProt	VAR_005583	L	662	P	RB_HUMAN	Disease (RB)	---	F	L	662	P
14	UniProt	VAR_005584	H	673	P	RB_HUMAN	Disease (RB)	---	F	H	673	P
15	UniProt	VAR_005585	Q	685	P	RB_HUMAN	Disease (RB)	---	F	Q	685	P
16	UniProt	VAR_051911	D	697	E	RB_HUMAN	Polymorphism	3092903	F	D	697	E
17	UniProt	VAR_005586	C	706	Y	RB_HUMAN	Disease (RB)	---	F	C	706	Y
18	UniProt	VAR_005587	C	712	R	RB_HUMAN	Disease (RB)	137853296	F	C	712	R
19	UniProt	VAR_034442	E	746	G	RB_HUMAN	Polymorphism	3092905	F	E	746	G

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (19, 19)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_019379	Q	436	K	RB_HUMAN	Polymorphism	4151534	G	Q	436	K
02	UniProt	VAR_010048	K	447	Q	RB_HUMAN	Disease (RB)	---	G	K	447	Q
03	UniProt	VAR_005576	M	457	R	RB_HUMAN	Disease (RB)	---	G	M	457	R
04	UniProt	VAR_011580	R	500	G	RB_HUMAN	Disease (RB)	---	G	R	500	G
05	UniProt	VAR_019380	A	525	G	RB_HUMAN	Polymorphism	4151539	G	A	525	G
06	UniProt	VAR_010049	K	530	R	RB_HUMAN	Disease (RB)	---	G	K	530	R
07	UniProt	VAR_005578	H	549	Y	RB_HUMAN	Disease (RB)	---	G	H	549	Y
08	UniProt	VAR_005579	S	567	L	RB_HUMAN	Disease (RB)	137853292	G	S	567	L
09	UniProt	VAR_051910	L	569	F	RB_HUMAN	Polymorphism	3092895	G	L	569	F
10	UniProt	VAR_005581	V	654	E	RB_HUMAN	Disease (RB)	---	H	V	654	E
11	UniProt	VAR_010050	L	657	P	RB_HUMAN	Disease (RB)	---	H	L	657	P
12	UniProt	VAR_005582	R	661	W	RB_HUMAN	Disease (RB)	137853294	H	R	661	W
13	UniProt	VAR_005583	L	662	P	RB_HUMAN	Disease (RB)	---	H	L	662	P
14	UniProt	VAR_005584	H	673	P	RB_HUMAN	Disease (RB)	---	H	H	673	P
15	UniProt	VAR_005585	Q	685	P	RB_HUMAN	Disease (RB)	---	H	Q	685	P
16	UniProt	VAR_051911	D	697	E	RB_HUMAN	Polymorphism	3092903	H	D	697	E
17	UniProt	VAR_005586	C	706	Y	RB_HUMAN	Disease (RB)	---	H	C	706	Y
18	UniProt	VAR_005587	C	712	R	RB_HUMAN	Disease (RB)	137853296	H	C	712	R
19	UniProt	VAR_034442	E	746	G	RB_HUMAN	Polymorphism	3092905	H	E	746	G

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (13, 52)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:194
 aligned with RB_HUMAN | P06400 from UniProtKB/Swiss-Prot  Length:928

    Alignment length:200
                                   388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578
             RB_HUMAN   379 MNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKD 578
               SCOP domains d1o9ka_ A: Retinoblastoma tumor suppressor domains                                                                                                                                                       SCOP domains
               CATH domains 1o9kA00 A:379-578  [code=1.10.472.10, no name defined]                                                                                                                                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh....hhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh...------......hhhhhhhhh.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------K----------Q---------R------------------------------------------G------------------------G----R------------------Y-----------------L-F--------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.12  PDB: A:379-405  Exon 1.13  PDB: A:406-444              Exon 1.14          Exon 1.15  -------------------------Exon 1.17  PDB: A:500-565 (gaps) UniProt: 500-565                 Exon 1.19     Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------Exon 1.16  PDB: A:474-500  ------------------------------------------------------------------------------ Transcript 1 (2)
                 1o9k A 379 MNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRS------SGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKD 578
                                   388       398       408       418       428       438       448       458       468       478       488       498  |    508       518       528       538       548       558       568       578
                                                                                                                                                    501    508

Chain B from PDB  Type:PROTEIN  Length:144
 aligned with RB_HUMAN | P06400 from UniProtKB/Swiss-Prot  Length:928

    Alignment length:144
                                   653       663       673       683       693       703       713       723       733       743       753       763       773       783    
             RB_HUMAN   644 STSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR 787
               SCOP domains d1o9kb_ B: Retinoblastoma tumor suppressor domains                                                                                               SCOP domains
               CATH domains 1o9kB00 B:644-787  [code=1.10.472.10, no name defined]                                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh....hhhhhhhhhh......hhhhhhee.....eehhhhhhhhhhhhhhhhhhhhh................ Sec.struct. author
                 SAPs(SNPs) ----------E--P---WP----------P-----------P-----------E--------Y-----R---------------------------------G----------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) ----------Exon 1.21  PDB: B:654-702 UniProt: 654-702       Exon 1.22  PDB: B:703-737          Exon 1.23  PDB: B:738-775             Exon 1.24    Transcript 1 (1)
           Transcript 1 (2) Exon 1.20b ------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1o9k B 644 STSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR 787
                                   653       663       673       683       693       703       713       723       733       743       753       763       773       783

Chain C from PDB  Type:PROTEIN  Length:194
 aligned with RB_HUMAN | P06400 from UniProtKB/Swiss-Prot  Length:928

    Alignment length:200
                                   388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578
             RB_HUMAN   379 MNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKD 578
               SCOP domains d1o9kc_ C: Retinoblastoma tumor suppressor domains                                                                                                                                                       SCOP domains
               CATH domains 1o9kC00 C:379-578  [code=1.10.472.10, no name defined]                                                                                                                                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh....hhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh...------......hhhhhhhhh.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------K----------Q---------R------------------------------------------G------------------------G----R------------------Y-----------------L-F--------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.12  PDB: C:379-405  Exon 1.13  PDB: C:406-444              Exon 1.14          Exon 1.15  -------------------------Exon 1.17  PDB: C:500-565 (gaps) UniProt: 500-565                 Exon 1.19     Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------Exon 1.16  PDB: C:474-500  ------------------------------------------------------------------------------ Transcript 1 (2)
                 1o9k C 379 MNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRS------SGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKD 578
                                   388       398       408       418       428       438       448       458       468       478       488       498  |    508       518       528       538       548       558       568       578
                                                                                                                                                    501    508

Chain D from PDB  Type:PROTEIN  Length:144
 aligned with RB_HUMAN | P06400 from UniProtKB/Swiss-Prot  Length:928

    Alignment length:144
                                   653       663       673       683       693       703       713       723       733       743       753       763       773       783    
             RB_HUMAN   644 STSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR 787
               SCOP domains d1o9kd_ D: Retinoblastoma tumor suppressor domains                                                                                               SCOP domains
               CATH domains 1o9kD00 D:644-787  [code=1.10.472.10, no name defined]                                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.....hhhhhhhhhh......hhhhhhee.....eehhhhhhhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ----------E--P---WP----------P-----------P-----------E--------Y-----R---------------------------------G----------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) ----------Exon 1.21  PDB: D:654-702 UniProt: 654-702       Exon 1.22  PDB: D:703-737          Exon 1.23  PDB: D:738-775             Exon 1.24    Transcript 1 (1)
           Transcript 1 (2) Exon 1.20b ------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1o9k D 644 STSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR 787
                                   653       663       673       683       693       703       713       723       733       743       753       763       773       783

Chain E from PDB  Type:PROTEIN  Length:194
 aligned with RB_HUMAN | P06400 from UniProtKB/Swiss-Prot  Length:928

    Alignment length:200
                                   388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578
             RB_HUMAN   379 MNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKD 578
               SCOP domains d1o9ke_ E: Retinoblastoma tumor suppressor domains                                                                                                                                                       SCOP domains
               CATH domains 1o9kE00 E:379-578  [code=1.10.472.10, no name defined]                                                                                                                                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh.......hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhh..------.......hhhhhhhh.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------K----------Q---------R------------------------------------------G------------------------G----R------------------Y-----------------L-F--------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.12  PDB: E:379-405  Exon 1.13  PDB: E:406-444              Exon 1.14          Exon 1.15  -------------------------Exon 1.17  PDB: E:500-565 (gaps) UniProt: 500-565                 Exon 1.19     Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------Exon 1.16  PDB: E:474-500  ------------------------------------------------------------------------------ Transcript 1 (2)
                 1o9k E 379 MNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRS------SGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKD 578
                                   388       398       408       418       428       438       448       458       468       478       488       498  |    508       518       528       538       548       558       568       578
                                                                                                                                                    501    508

Chain F from PDB  Type:PROTEIN  Length:144
 aligned with RB_HUMAN | P06400 from UniProtKB/Swiss-Prot  Length:928

    Alignment length:144
                                   653       663       673       683       693       703       713       723       733       743       753       763       773       783    
             RB_HUMAN   644 STSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR 787
               SCOP domains d1o9kf_ F: Retinoblastoma tumor suppressor domains                                                                                               SCOP domains
               CATH domains 1o9kF00 F:644-787  [code=1.10.472.10, no name defined]                                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh....hhhhhhhhhh......hhhhhhee.....eehhhhhhhhhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) ----------E--P---WP----------P-----------P-----------E--------Y-----R---------------------------------G----------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) ----------Exon 1.21  PDB: F:654-702 UniProt: 654-702       Exon 1.22  PDB: F:703-737          Exon 1.23  PDB: F:738-775             Exon 1.24    Transcript 1 (1)
           Transcript 1 (2) Exon 1.20b ------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1o9k F 644 STSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR 787
                                   653       663       673       683       693       703       713       723       733       743       753       763       773       783

Chain G from PDB  Type:PROTEIN  Length:194
 aligned with RB_HUMAN | P06400 from UniProtKB/Swiss-Prot  Length:928

    Alignment length:200
                                   388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578
             RB_HUMAN   379 MNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKD 578
               SCOP domains d1o9kg_ G: Retinoblastoma tumor suppressor domains                                                                                                                                                       SCOP domains
               CATH domains 1o9kG00 G:379-578  [code=1.10.472.10, no name defined]                                                                                                                                                   CATH domains
           Pfam domains (1) RB_A-1o9kG01 G:379-573                                                                                                                                                                             ----- Pfam domains (1)
           Pfam domains (2) RB_A-1o9kG02 G:379-573                                                                                                                                                                             ----- Pfam domains (2)
           Pfam domains (3) RB_A-1o9kG03 G:379-573                                                                                                                                                                             ----- Pfam domains (3)
           Pfam domains (4) RB_A-1o9kG04 G:379-573                                                                                                                                                                             ----- Pfam domains (4)
         Sec.struct. author .hhhhhhhhh........hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.------.....hhhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------K----------Q---------R------------------------------------------G------------------------G----R------------------Y-----------------L-F--------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.12  PDB: G:379-405  Exon 1.13  PDB: G:406-444              Exon 1.14          Exon 1.15  -------------------------Exon 1.17  PDB: G:500-565 (gaps) UniProt: 500-565                 Exon 1.19     Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------Exon 1.16  PDB: G:474-500  ------------------------------------------------------------------------------ Transcript 1 (2)
                 1o9k G 379 MNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRS------SGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKD 578
                                   388       398       408       418       428       438       448       458       468       478       488       498  |    508       518       528       538       548       558       568       578
                                                                                                                                                    501    508

Chain H from PDB  Type:PROTEIN  Length:144
 aligned with RB_HUMAN | P06400 from UniProtKB/Swiss-Prot  Length:928

    Alignment length:144
                                   653       663       673       683       693       703       713       723       733       743       753       763       773       783    
             RB_HUMAN   644 STSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR 787
               SCOP domains d1o9kh_ H: Retinoblastoma tumor suppressor domains                                                                                               SCOP domains
               CATH domains 1o9kH00 H:644-787  [code=1.10.472.10, no name defined]                                                                                           CATH domains
           Pfam domains (1) -RB_B-1o9kH01 H:645-766                                                                                                    -Rb_C-1o9kH05         Pfam domains (1)
           Pfam domains (2) -RB_B-1o9kH02 H:645-766                                                                                                    -Rb_C-1o9kH06         Pfam domains (2)
           Pfam domains (3) -RB_B-1o9kH03 H:645-766                                                                                                    -Rb_C-1o9kH07         Pfam domains (3)
           Pfam domains (4) -RB_B-1o9kH04 H:645-766                                                                                                    -Rb_C-1o9kH08         Pfam domains (4)
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh....hhhhhhhhhh......hhhhhhee.....eehhhhhhhhhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) ----------E--P---WP----------P-----------P-----------E--------Y-----R---------------------------------G----------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) ----------Exon 1.21  PDB: H:654-702 UniProt: 654-702       Exon 1.22  PDB: H:703-737          Exon 1.23  PDB: H:738-775             Exon 1.24    Transcript 1 (1)
           Transcript 1 (2) Exon 1.20b ------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1o9k H 644 STSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR 787
                                   653       663       673       683       693       703       713       723       733       743       753       763       773       783

Chain P from PDB  Type:PROTEIN  Length:18
 aligned with E2F1_HUMAN | Q01094 from UniProtKB/Swiss-Prot  Length:437

    Alignment length:18
                                   418        
           E2F1_HUMAN   409 LDYHFGLEEGEGIRDLFD 426
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author ...........hhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE ------------------ PROSITE
               Transcript 2 Exon 2.7           Transcript 2
                 1o9k P 409 LDYHFGLEEGEGIRDLFD 426
                                   418

Chain Q from PDB  Type:PROTEIN  Length:18
 aligned with E2F1_HUMAN | Q01094 from UniProtKB/Swiss-Prot  Length:437

    Alignment length:18
                                   418        
           E2F1_HUMAN   409 LDYHFGLEEGEGIRDLFD 426
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author ...........hhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE ------------------ PROSITE
               Transcript 2 Exon 2.7           Transcript 2
                 1o9k Q 409 LDYHFGLEEGEGIRDLFD 426
                                   418

Chain R from PDB  Type:PROTEIN  Length:18
 aligned with E2F1_HUMAN | Q01094 from UniProtKB/Swiss-Prot  Length:437

    Alignment length:18
                                   418        
           E2F1_HUMAN   409 LDYHFGLEEGEGIRDLFD 426
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author ...........hhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE ------------------ PROSITE
               Transcript 2 Exon 2.7           Transcript 2
                 1o9k R 409 LDYHFGLEEGEGIRDLFD 426
                                   418

Chain S from PDB  Type:PROTEIN  Length:18
 aligned with E2F1_HUMAN | Q01094 from UniProtKB/Swiss-Prot  Length:437

    Alignment length:18
                                   418        
           E2F1_HUMAN   409 LDYHFGLEEGEGIRDLFD 426
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author ...........hhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE ------------------ PROSITE
               Transcript 2 Exon 2.7           Transcript 2
                 1o9k S 409 LDYHFGLEEGEGIRDLFD 426
                                   418

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 8)

CATH Domains (1, 8)

Pfam Domains (3, 12)

Gene Ontology (101, 121)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F,G,H (RB_HUMAN | P06400)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0001102	RNA polymerase II activating transcription factor binding	Interacting selectively and non-covalently with an RNA polymerase II transcription activating factor, a protein involved in positive regulation of transcription.
	GO:0050681	androgen receptor binding	Interacting selectively and non-covalently with an androgen receptor.
	GO:0001047	core promoter binding	Interacting selectively and non-covalently with the regulatory region composed of the transcription start site and binding sites for the basal transcription machinery. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0019900	kinase binding	Interacting selectively and non-covalently with a kinase, any enzyme that catalyzes the transfer of a phosphate group.
	GO:0051219	phosphoprotein binding	Interacting selectively and non-covalently with a phosphorylated protein.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0003713	transcription coactivator activity	Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0031625	ubiquitin protein ligase binding	Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
	GO:0000082	G1/S transition of mitotic cell cycle	The mitotic cell cycle transition by which a cell in G1 commits to S phase. The process begins with the build up of G1 cyclin-dependent kinase (G1 CDK), resulting in the activation of transcription of G1 cyclins. The process ends with the positive feedback of the G1 cyclins on the G1 CDK which commits the cell to S phase, in which DNA replication is initiated.
	GO:0007265	Ras protein signal transduction	A series of molecular signals within the cell that are mediated by a member of the Ras superfamily of proteins switching to a GTP-bound active state.
	GO:0030521	androgen receptor signaling pathway	Any series of molecular signals generated as a consequence of an androgen binding to its receptor.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0007050	cell cycle arrest	A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
	GO:0000075	cell cycle checkpoint	A cell cycle process that controls cell cycle progression by monitoring the integrity of specific cell cycle events. A cell cycle checkpoint begins with detection of deficiencies or defects and ends with signal transduction.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0048667	cell morphogenesis involved in neuron differentiation	The process in which the structures of a neuron are generated and organized. This process occurs while the initially relatively unspecialized cell is acquiring the specialized features of a neuron.
	GO:0071466	cellular response to xenobiotic stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a xenobiotic compound stimulus. Xenobiotic compounds are compounds foreign to living organisms.
	GO:0006338	chromatin remodeling	Dynamic structural changes to eukaryotic chromatin occurring throughout the cell division cycle. These changes range from the local changes necessary for transcriptional regulation to global changes necessary for chromosome segregation.
	GO:0048565	digestive tract development	The process whose specific outcome is the progression of the digestive tract over time, from its formation to the mature structure. The digestive tract is the anatomical structure through which food passes and is processed.
	GO:0043353	enucleate erythrocyte differentiation	The process in which a myeloid precursor cell acquires specialized features of an erythrocyte without a nucleus. An example of this process is found in Mus musculus.
	GO:0034349	glial cell apoptotic process	Any apoptotic process in a glial cell, a non-neuronal cell of the nervous system.
	GO:0097284	hepatocyte apoptotic process	Any apoptotic process in a hepatocyte, the main structural component of the liver.
	GO:0034088	maintenance of mitotic sister chromatid cohesion	The process in which the association between sister chromatids of a replicated chromosome is maintained as chromosomes condense, attach to the spindle in a bipolar orientation, and congress to the metaphase plate during a mitotic cell cycle.
	GO:0007093	mitotic cell cycle checkpoint	A cell cycle checkpoint that ensures accurate chromosome replication and segregation by preventing progression through a mitotic cell cycle until conditions are suitable for the cell to proceed to the next stage.
	GO:0045445	myoblast differentiation	The process in which a relatively unspecialized cell acquires specialized features of a myoblast. A myoblast is a mononucleate cell type that, by fusion with other myoblasts, gives rise to the myotubes that eventually develop into striated muscle fibers.
	GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	Any cell cycle regulatory process that prevents the commitment of a cell from G1 to S phase of the mitotic cell cycle.
	GO:0045786	negative regulation of cell cycle	Any process that stops, prevents or reduces the rate or extent of progression through the cell cycle.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0050680	negative regulation of epithelial cell proliferation	Any process that stops, prevents or reduces the rate or extent of epithelial cell proliferation.
	GO:0010629	negative regulation of gene expression	Any process that decreases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0045930	negative regulation of mitotic cell cycle	Any process that stops, prevents or reduces the rate or extent of progression through the mitotic cell cycle.
	GO:0006469	negative regulation of protein kinase activity	Any process that stops, prevents, or reduces the frequency, rate or extent of protein kinase activity.
	GO:0043433	negative regulation of sequence-specific DNA binding transcription factor activity	Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
	GO:0045879	negative regulation of smoothened signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of smoothened signaling.
	GO:0000122	negative regulation of transcription from RNA polymerase II promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0007070	negative regulation of transcription from RNA polymerase II promoter during mitotic cell cycle	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter that occurs during the mitotic cell cycle.
	GO:0071930	negative regulation of transcription involved in G1/S transition of mitotic cell cycle	Any process that stop, prevents or decreases transcription as part of the G1/S transition of the mitotic cell cycle.
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0051402	neuron apoptotic process	Any apoptotic process in a neuron, the basic cellular unit of nervous tissue. Each neuron consists of a body, an axon, and dendrites. Their purpose is to receive, conduct, and transmit impulses in the nervous system.
	GO:0030182	neuron differentiation	The process in which a relatively unspecialized cell acquires specialized features of a neuron.
	GO:0042551	neuron maturation	A developmental process, independent of morphogenetic (shape) change, that is required for a neuron to attain its fully functional state.
	GO:0031175	neuron projection development	The process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
	GO:0045651	positive regulation of macrophage differentiation	Any process that activates or increases the frequency, rate or extent of macrophage differentiation.
	GO:0045842	positive regulation of mitotic metaphase/anaphase transition	Any process that activates or increases the frequency, rate or extent of the cell cycle process in which a cell progresses from metaphase to anaphase during mitosis, triggered by the activation of the anaphase promoting complex by Cdc20/Sleepy homolog which results in the degradation of Securin.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:2000679	positive regulation of transcription regulatory region DNA binding	Any process that activates or increases the frequency, rate or extent of transcription regulatory region DNA binding.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0071459	protein localization to chromosome, centromeric region	Any process in which a protein is transported to, or maintained at, the centromeric region of a chromosome.
	GO:0051726	regulation of cell cycle	Any process that modulates the rate or extent of progression through the cell cycle.
	GO:0090230	regulation of centromere complex assembly	Any process that modulates the rate, frequency, or extent of centromere complex assembly, the aggregation, arrangement and bonding together of proteins and centromeric DNA molecules to form a centromeric protein-DNA complex.
	GO:0071922	regulation of cohesin loading	Any process that modulates the frequency, rate or extent of a process in which a cohesin complex is transported to, or maintained at, a part of a chromosome that is organized into chromatin.
	GO:0043550	regulation of lipid kinase activity	Any process that modulates the frequency, rate or extent of lipid kinase activity, the catalysis of the transfer of a phosphate group, usually from ATP, to a simple or complex lipid.
	GO:0007346	regulation of mitotic cell cycle	Any process that modulates the rate or extent of progress through the mitotic cell cycle.
	GO:0006357	regulation of transcription from RNA polymerase II promoter	Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	Any process that regulates transcription such that the target genes are involved in the transition between G1 and S phase of the mitotic cell cycle.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0031134	sister chromatid biorientation	The cell cycle process in which sister chromatids establish stable attachments to microtubules emanating from opposite spindle poles.
	GO:0035914	skeletal muscle cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of a skeletal muscle cell, a somatic cell located in skeletal muscle.
	GO:0051146	striated muscle cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of a striated muscle cell; striated muscle fibers are divided by transverse bands into striations, and cardiac and voluntary muscle are types of striated muscle.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0016605	PML body	A class of nuclear body; they react against SP100 auto-antibodies (PML, promyelocytic leukemia); cells typically contain 10-30 PML bodies per nucleus; alterations in the localization of PML bodies occurs after viral infection.
	GO:0035189	Rb-E2F complex	A multiprotein complex containing a heterodimeric E2F transcription factor and a Retinoblastoma (Rb) family member. This complex is capable of repressing transcription of E2F-regulated genes in order to regulate cell cycle progression.
	GO:0016514	SWI/SNF complex	A SWI/SNF-type complex that contains nine or more proteins, including both conserved (core) and nonconserved components; the Swi2/Snf2 ATPase is one of the core components.
	GO:0000785	chromatin	The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome.
	GO:0008024	cyclin/CDK positive transcription elongation factor complex	A transcription elongation factor complex that facilitates the transition from abortive to productive elongation by phosphorylating the CTD domain of the large subunit of DNA-directed RNA polymerase II, holoenzyme. Contains a cyclin and a cyclin-dependent protein kinase catalytic subunit.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005819	spindle	The array of microtubules and associated molecules that forms between opposite poles of a eukaryotic cell during mitosis or meiosis and serves to move the duplicated chromosomes apart.
	GO:0005667	transcription factor complex	A protein complex that is capable of associating with DNA by direct binding, or via other DNA-binding proteins or complexes, and regulating transcription.

Chain P,Q,R,S (E2F1_HUMAN | Q01094)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0001047	core promoter binding	Interacting selectively and non-covalently with the regulatory region composed of the transcription start site and binding sites for the basal transcription machinery. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0044212	transcription regulatory region DNA binding	Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
biological process
	GO:0000077	DNA damage checkpoint	A cell cycle checkpoint that regulates progression through the cell cycle in response to DNA damage. A DNA damage checkpoint may blocks cell cycle progression (in G1, G2 or metaphase) or slow the rate at which S phase proceeds.
	GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage and resulting in the stopping or reduction in rate of the cell cycle.
	GO:0043276	anoikis	Apoptosis triggered by inadequate or inappropriate adherence to substrate e.g. after disruption of the interactions between normal epithelial cells and the extracellular matrix.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0071398	cellular response to fatty acid	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a fatty acid stimulus.
	GO:0071456	cellular response to hypoxia	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
	GO:1990090	cellular response to nerve growth factor stimulus	A process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nerve growth factor stimulus.
	GO:0071466	cellular response to xenobiotic stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a xenobiotic compound stimulus. Xenobiotic compounds are compounds foreign to living organisms.
	GO:0030900	forebrain development	The process whose specific outcome is the progression of the forebrain over time, from its formation to the mature structure. The forebrain is the anterior of the three primary divisions of the developing chordate brain or the corresponding part of the adult brain (in vertebrates, includes especially the cerebral hemispheres, the thalamus, and the hypothalamus and especially in higher vertebrates is the main control center for sensory and associative information processing, visceral functions, and voluntary motor functions).
	GO:0072332	intrinsic apoptotic signaling pathway by p53 class mediator	A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, and ends when the execution phase of apoptosis is triggered.
	GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
	GO:1990086	lens fiber cell apoptotic process	Any apoptotic process in a lens fiber cell. Lens fiber cells are elongated, tightly packed cells that make up the bulk of the mature lens in a camera-type eye.
	GO:0048255	mRNA stabilization	Prevention of degradation of mRNA molecules. In the absence of compensating changes in other processes, the slowing of mRNA degradation can result in an overall increase in the population of active mRNA molecules.
	GO:0043392	negative regulation of DNA binding	Any process that stops or reduces the frequency, rate or extent of DNA binding. DNA binding is any process in which a gene product interacts selectively with DNA (deoxyribonucleic acid).
	GO:0045599	negative regulation of fat cell differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of adipocyte differentiation.
	GO:0070345	negative regulation of fat cell proliferation	Any process that stops or decreases the rate or extent of fat cell proliferation.
	GO:0000122	negative regulation of transcription from RNA polymerase II promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0071930	negative regulation of transcription involved in G1/S transition of mitotic cell cycle	Any process that stop, prevents or decreases transcription as part of the G1/S transition of the mitotic cell cycle.
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0048146	positive regulation of fibroblast proliferation	Any process that activates or increases the frequency, rate or extent of multiplication or reproduction of fibroblast cells.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	Any process that activates or increases the frequency, rate or extent of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:2000045	regulation of G1/S transition of mitotic cell cycle	Any cell cycle regulatory process that controls the commitment of a cell from G1 to S phase of the mitotic cell cycle.
	GO:0051726	regulation of cell cycle	Any process that modulates the rate or extent of progression through the cell cycle.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0007283	spermatogenesis	The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0035189	Rb-E2F complex	A multiprotein complex containing a heterodimeric E2F transcription factor and a Retinoblastoma (Rb) family member. This complex is capable of repressing transcription of E2F-regulated genes in order to regulate cell cycle progression.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0000790	nuclear chromatin	The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005667	transcription factor complex	A protein complex that is capable of associating with DNA by direct binding, or via other DNA-binding proteins or complexes, and regulating transcription.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (1, 1)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (19, 76)

PROSITE Motifs (0, 0)

Exons (13, 52)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 8)

CATH Domains (1, 8)

Pfam Domains (3, 12)

Gene Ontology (101, 121)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File