1XNI - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Biological Unit 5 (Jmol Viewer)

Biological Unit 6 (Jmol Viewer)

Biological Unit 7 (Jmol Viewer)

Biological Unit 8 (Jmol Viewer)

Biological Unit 9 (Jmol Viewer)

Biological Unit 10 (Jmol Viewer)

Title :   TANDEM TUDOR DOMAIN OF 53BP1

Authors :   Y. Huyen, O. Zgheib, R. A. Ditullio Jr. , V. G. Gorgoulis, P. Zacharatos, T. J. Petty, E. A. Sheston, H. S. Mellert, E. S. Stavridi T. D. Halazonetis

Date :   05 Oct 04 (Deposition) - 30 Nov 04 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.80

Chains :   Asym. Unit : A,B,C,D,E,F,G,H,I,J
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)
Biol. Unit 5: E  (1x)
Biol. Unit 6: F  (1x)
Biol. Unit 7: G  (1x)
Biol. Unit 8: H  (1x)
Biol. Unit 9: I  (1x)
Biol. Unit 10: J  (1x)

Keywords :   Beta-Barrel, Bent Beta-Sheet, Cell Cycle (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Huyen, O. Zgheib, R. A. Ditullio Jr. , V. G. Gorgoulis, P. Zacharatos, T. J. Petty, E. A. Sheston, H. S. Mellert, E. S. Stavridi, T. D. Halazonetis
Methylated Lysine 79 Of Histone H3 Targets 53Bp1 To Dna Double-Strand Breaks
Nature V. 432 406 2004
PubMed-ID: 15525939 | Reference-DOI: 10.1038/NATURE03114
(for further references see the PDB file header)

Molecule 1 - TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
	Chains	:	A, B, C, D, E, F, G, H, I, J
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Fragment	:	RESIDUES 1485-1602
	Gene	:	TP53BP1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	P53-BINDING PROTEIN 1, 53BP1, TUDOR

		1	2	3	4	5	6	7	8	9	10
Asymmetric Unit	:	A	B	C	D	E	F	G	H	I	J
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D
Biological Unit 5 (1x)	:					E
Biological Unit 6 (1x)	:						F
Biological Unit 7 (1x)	:							G
Biological Unit 8 (1x)	:								H
Biological Unit 9 (1x)	:									I
Biological Unit 10 (1x)	:										J

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1XNI)

(no "Site" information available for 1XNI)

(no "SS Bond" information available for 1XNI)

Asymmetric Unit

No.	Residues
1	Asp A:1536	-	Pro A:1537
2	Asp B:1536	-	Pro B:1537
3	Asp C:1536	-	Pro C:1537
4	Asp D:1536	-	Pro D:1537
5	Asp E:1536	-	Pro E:1537
6	Asp F:1536	-	Pro F:1537
7	Asp G:1536	-	Pro G:1537
8	Asp H:1536	-	Pro H:1537
9	Asp I:1536	-	Pro I:1537
10	Asp J:1536	-	Pro J:1537

Asymmetric Unit (1, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_038689	G	1488	W	TP53B_HUMAN	Polymorphism	11554564	A/B/C/D/E/F/G/H/I/J	G	1488	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_038689	G	1488	W	TP53B_HUMAN	Polymorphism	11554564	A	G	1488	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_038689	G	1488	W	TP53B_HUMAN	Polymorphism	11554564	B	G	1488	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_038689	G	1488	W	TP53B_HUMAN	Polymorphism	11554564	C	G	1488	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_038689	G	1488	W	TP53B_HUMAN	Polymorphism	11554564	D	G	1488	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 5 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_038689	G	1488	W	TP53B_HUMAN	Polymorphism	11554564	E	G	1488	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 6 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_038689	G	1488	W	TP53B_HUMAN	Polymorphism	11554564	F	G	1488	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 7 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_038689	G	1488	W	TP53B_HUMAN	Polymorphism	11554564	G	G	1488	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 8 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_038689	G	1488	W	TP53B_HUMAN	Polymorphism	11554564	H	G	1488	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 9 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_038689	G	1488	W	TP53B_HUMAN	Polymorphism	11554564	I	G	1488	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 10 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_038689	G	1488	W	TP53B_HUMAN	Polymorphism	11554564	J	G	1488	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 1XNI)

Asymmetric Unit (2, 20)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000263801	1b	ENSE00001344404	chr15:43802812-43802568	245	TP53B_HUMAN	-	0	0	-	-
1.4	ENST00000263801	4	ENSE00001713374	chr15:43784666-43784482	185	TP53B_HUMAN	1-59	59	0	-	-
1.5	ENST00000263801	5	ENSE00001046179	chr15:43784293-43784200	94	TP53B_HUMAN	60-91	32	0	-	-
1.6	ENST00000263801	6	ENSE00001046160	chr15:43783951-43783867	85	TP53B_HUMAN	91-119	29	0	-	-
1.7	ENST00000263801	7	ENSE00001046169	chr15:43773220-43773093	128	TP53B_HUMAN	119-162	44	0	-	-
1.8	ENST00000263801	8	ENSE00001046152	chr15:43772215-43772057	159	TP53B_HUMAN	162-215	54	0	-	-
1.9	ENST00000263801	9	ENSE00001046208	chr15:43771724-43771595	130	TP53B_HUMAN	215-258	44	0	-	-
1.10	ENST00000263801	10	ENSE00001046166	chr15:43769957-43769791	167	TP53B_HUMAN	258-314	57	0	-	-
1.11	ENST00000263801	11	ENSE00001046193	chr15:43767892-43767763	130	TP53B_HUMAN	314-357	44	0	-	-
1.12	ENST00000263801	12	ENSE00001046180	chr15:43766965-43766871	95	TP53B_HUMAN	357-389	33	0	-	-
1.13	ENST00000263801	13	ENSE00001046161	chr15:43762264-43762056	209	TP53B_HUMAN	389-458	70	0	-	-
1.14a	ENST00000263801	14a	ENSE00001046204	chr15:43749416-43748090	1327	TP53B_HUMAN	459-901	443	0	-	-
1.15a	ENST00000263801	15a	ENSE00001046164	chr15:43739683-43739564	120	TP53B_HUMAN	901-941	41	0	-	-
1.17	ENST00000263801	17	ENSE00001628086	chr15:43738788-43738585	204	TP53B_HUMAN	941-1009	69	0	-	-
1.18a	ENST00000263801	18a	ENSE00001675565	chr15:43733781-43733724	58	TP53B_HUMAN	1009-1028	20	0	-	-
1.19a	ENST00000263801	19a	ENSE00001595850	chr15:43730614-43730522	93	TP53B_HUMAN	1028-1059	32	0	-	-
1.20b	ENST00000263801	20b	ENSE00001729133	chr15:43724875-43724392	484	TP53B_HUMAN	1059-1220	162	0	-	-
1.21a	ENST00000263801	21a	ENSE00001648704	chr15:43720366-43720214	153	TP53B_HUMAN	1221-1271	51	0	-	-
1.22a	ENST00000263801	22a	ENSE00001612038	chr15:43714324-43714053	272	TP53B_HUMAN	1272-1362	91	0	-	-
1.23b	ENST00000263801	23b	ENSE00001657667	chr15:43713372-43713223	150	TP53B_HUMAN	1362-1412	51	0	-	-
1.24a	ENST00000263801	24a	ENSE00001735071	chr15:43712933-43712503	431	TP53B_HUMAN	1412-1556	145	10	A:1485-1556 B:1485-1556 C:1485-1556 D:1485-1556 E:1485-1556 F:1485-1556 G:1485-1556 H:1485-1556 I:1485-1556 J:1485-1556	72 72 72 72 72 72 72 72 72 72
1.25b	ENST00000263801	25b	ENSE00001666968	chr15:43708614-43708423	192	TP53B_HUMAN	1556-1620	65	10	A:1556-1602 B:1556-1602 C:1556-1602 D:1556-1602 E:1556-1602 F:1556-1602 G:1556-1602 H:1556-1602 I:1556-1602 J:1556-1602	47 47 47 47 47 47 47 47 47 47
1.26	ENST00000263801	26	ENSE00001684657	chr15:43708007-43707792	216	TP53B_HUMAN	1620-1692	73	0	-	-
1.28b	ENST00000263801	28b	ENSE00001734669	chr15:43705532-43705317	216	TP53B_HUMAN	1692-1764	73	0	-	-
1.30	ENST00000263801	30	ENSE00001771292	chr15:43701939-43701845	95	TP53B_HUMAN	1764-1795	32	0	-	-
1.31b	ENST00000263801	31b	ENSE00001727562	chr15:43701294-43701095	200	TP53B_HUMAN	1796-1862	67	0	-	-
1.32	ENST00000263801	32	ENSE00001751396	chr15:43700286-43700141	146	TP53B_HUMAN	1862-1911	50	0	-	-
1.33b	ENST00000263801	33b	ENSE00001841464	chr15:43699768-43699407	362	TP53B_HUMAN	1911-1972	62	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:118
 aligned with TP53B_HUMAN | Q12888 from UniProtKB/Swiss-Prot  Length:1972

    Alignment length:118
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594        
         TP53B_HUMAN   1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
               SCOP domains d1xnia1 A:1485-1537 p53-binding protein 1, 53BP1     d1xnia2 A:1538-1602 p53-binding protein 1, 53BP1                  SCOP domains
               CATH domains 1xniA01 A:1485-1538                                   1xniA02 A:1539-1602  [code=2.30.30.30, no name defined]          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee........eeeeeeee....eeeeee....eeeee...ee.........eeee........eeeeeeeee....eeeeeee..eeeeee...ee.hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---W------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.24a  PDB: A:1485-1556 UniProt: 1412-1556 [INCOMPLETE]            ---------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------Exon 1.25b  PDB: A:1556-1602 UniProt: 1556-1620 Transcript 1 (2)
                1xni A 1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594

Chain B from PDB  Type:PROTEIN  Length:118
 aligned with TP53B_HUMAN | Q12888 from UniProtKB/Swiss-Prot  Length:1972

    Alignment length:118
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594        
         TP53B_HUMAN   1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
               SCOP domains d1xnib1 B:1485-1537 p53-binding protein 1, 53BP1     d1xnib2 B:1538-1602 p53-binding protein 1, 53BP1                  SCOP domains
               CATH domains 1xniB01 B:1485-1538                                   1xniB02 B:1539-1602  [code=2.30.30.30, no name defined]          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee........eeeeeeee....eeeeee....eeeee...ee.........eeee........eeeeeeeee....eeeeeee..eeeeee...ee.hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---W------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.24a  PDB: B:1485-1556 UniProt: 1412-1556 [INCOMPLETE]            ---------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------Exon 1.25b  PDB: B:1556-1602 UniProt: 1556-1620 Transcript 1 (2)
                1xni B 1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594

Chain C from PDB  Type:PROTEIN  Length:118
 aligned with TP53B_HUMAN | Q12888 from UniProtKB/Swiss-Prot  Length:1972

    Alignment length:118
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594        
         TP53B_HUMAN   1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
               SCOP domains d1xnic1 C:1485-1537 p53-binding protein 1, 53BP1     d1xnic2 C:1538-1602 p53-binding protein 1, 53BP1                  SCOP domains
               CATH domains 1xniC01 C:1485-1538                                   1xniC02 C:1539-1602  [code=2.30.30.30, no name defined]          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee........eeeeeeee....eeeeee....eeeee...ee.........eeee........eeeeeeeee....eeeeeee..eeeeee...ee.hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---W------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.24a  PDB: C:1485-1556 UniProt: 1412-1556 [INCOMPLETE]            ---------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------Exon 1.25b  PDB: C:1556-1602 UniProt: 1556-1620 Transcript 1 (2)
                1xni C 1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594

Chain D from PDB  Type:PROTEIN  Length:118
 aligned with TP53B_HUMAN | Q12888 from UniProtKB/Swiss-Prot  Length:1972

    Alignment length:118
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594        
         TP53B_HUMAN   1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
               SCOP domains d1xnid1 D:1485-1537 p53-binding protein 1, 53BP1     d1xnid2 D:1538-1602 p53-binding protein 1, 53BP1                  SCOP domains
               CATH domains 1xniD01 D:1485-1538                                   1xniD02 D:1539-1602  [code=2.30.30.30, no name defined]          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee........eeeeeeee....eeeeee....eeeee...ee.........eeee........eeeeeeeee....eeeeeee..eeeeee...ee.hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---W------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.24a  PDB: D:1485-1556 UniProt: 1412-1556 [INCOMPLETE]            ---------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------Exon 1.25b  PDB: D:1556-1602 UniProt: 1556-1620 Transcript 1 (2)
                1xni D 1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594

Chain E from PDB  Type:PROTEIN  Length:118
 aligned with TP53B_HUMAN | Q12888 from UniProtKB/Swiss-Prot  Length:1972

    Alignment length:118
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594        
         TP53B_HUMAN   1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
               SCOP domains d1xnie1 E:1485-1537 p53-binding protein 1, 53BP1     d1xnie2 E:1538-1602 p53-binding protein 1, 53BP1                  SCOP domains
               CATH domains 1xniE01 E:1485-1538                                   1xniE02 E:1539-1602  [code=2.30.30.30, no name defined]          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee........eeeeeeee....eeeeee....eeeee...ee.........eeee........eeeeeeeee....eeeeeee..eeeeee...ee.hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---W------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.24a  PDB: E:1485-1556 UniProt: 1412-1556 [INCOMPLETE]            ---------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------Exon 1.25b  PDB: E:1556-1602 UniProt: 1556-1620 Transcript 1 (2)
                1xni E 1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594

Chain F from PDB  Type:PROTEIN  Length:118
 aligned with TP53B_HUMAN | Q12888 from UniProtKB/Swiss-Prot  Length:1972

    Alignment length:118
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594        
         TP53B_HUMAN   1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
               SCOP domains d1xnif1 F:1485-1537 p53-binding protein 1, 53BP1     d1xnif2 F:1538-1602 p53-binding protein 1, 53BP1                  SCOP domains
               CATH domains 1xniF01 F:1485-1538                                   1xniF02 F:1539-1602  [code=2.30.30.30, no name defined]          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee........eeeeeeee....eeeeee....eeeee...ee.........eeee........eeeeeeeee....eeeeeee..eeeeee...ee.hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---W------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.24a  PDB: F:1485-1556 UniProt: 1412-1556 [INCOMPLETE]            ---------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------Exon 1.25b  PDB: F:1556-1602 UniProt: 1556-1620 Transcript 1 (2)
                1xni F 1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594

Chain G from PDB  Type:PROTEIN  Length:118
 aligned with TP53B_HUMAN | Q12888 from UniProtKB/Swiss-Prot  Length:1972

    Alignment length:118
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594        
         TP53B_HUMAN   1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
               SCOP domains d1xnig1 G:1485-1537 p53-binding protein 1, 53BP1     d1xnig2 G:1538-1602 p53-binding protein 1, 53BP1                  SCOP domains
               CATH domains 1xniG01 G:1485-1538                                   1xniG02 G:1539-1602  [code=2.30.30.30, no name defined]          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee........eeeeeeee....eeeeee....eeeee...ee.........eeee........eeeeeeeee....eeeeeee..eeeeee...ee.hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---W------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.24a  PDB: G:1485-1556 UniProt: 1412-1556 [INCOMPLETE]            ---------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------Exon 1.25b  PDB: G:1556-1602 UniProt: 1556-1620 Transcript 1 (2)
                1xni G 1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594

Chain H from PDB  Type:PROTEIN  Length:118
 aligned with TP53B_HUMAN | Q12888 from UniProtKB/Swiss-Prot  Length:1972

    Alignment length:118
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594        
         TP53B_HUMAN   1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
               SCOP domains d1xnih1 H:1485-1537 p53-binding protein 1, 53BP1     d1xnih2 H:1538-1602 p53-binding protein 1, 53BP1                  SCOP domains
               CATH domains 1xniH01 H:1485-1538                                   1xniH02 H:1539-1602  [code=2.30.30.30, no name defined]          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee........eeeeeeee....eeeeee....eeeee...ee.........eeee........eeeeeeeee....eeeeeee..eeeeee...ee.hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---W------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.24a  PDB: H:1485-1556 UniProt: 1412-1556 [INCOMPLETE]            ---------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------Exon 1.25b  PDB: H:1556-1602 UniProt: 1556-1620 Transcript 1 (2)
                1xni H 1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594

Chain I from PDB  Type:PROTEIN  Length:118
 aligned with TP53B_HUMAN | Q12888 from UniProtKB/Swiss-Prot  Length:1972

    Alignment length:118
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594        
         TP53B_HUMAN   1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
               SCOP domains d1xnii1 I:1485-1537 p53-binding protein 1, 53BP1     d1xnii2 I:1538-1602 p53-binding protein 1, 53BP1                  SCOP domains
               CATH domains 1xniI01 I:1485-1538                                   1xniI02 I:1539-1602  [code=2.30.30.30, no name defined]          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee........eeeeeeee....eeeeee....eeeee...ee.........eeee........eeeeeeeee....eeeeeee..eeeeee...ee.hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---W------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.24a  PDB: I:1485-1556 UniProt: 1412-1556 [INCOMPLETE]            ---------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------Exon 1.25b  PDB: I:1556-1602 UniProt: 1556-1620 Transcript 1 (2)
                1xni I 1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594

Chain J from PDB  Type:PROTEIN  Length:118
 aligned with TP53B_HUMAN | Q12888 from UniProtKB/Swiss-Prot  Length:1972

    Alignment length:118
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594        
         TP53B_HUMAN   1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
               SCOP domains d1xnij1 J:1485-1537 p53-binding protein 1, 53BP1     d1xnij2 J:1538-1602 p53-binding protein 1, 53BP1                  SCOP domains
               CATH domains 1xniJ01 J:1485-1538                                   1xniJ02 J:1539-1602  [code=2.30.30.30, no name defined]          CATH domains
           Pfam domains (1) 53-BP1_Tudor-1xniJ01 J:1485-1602                                                                                       Pfam domains (1)
           Pfam domains (2) 53-BP1_Tudor-1xniJ02 J:1485-1602                                                                                       Pfam domains (2)
           Pfam domains (3) 53-BP1_Tudor-1xniJ03 J:1485-1602                                                                                       Pfam domains (3)
           Pfam domains (4) 53-BP1_Tudor-1xniJ04 J:1485-1602                                                                                       Pfam domains (4)
           Pfam domains (5) 53-BP1_Tudor-1xniJ05 J:1485-1602                                                                                       Pfam domains (5)
           Pfam domains (6) 53-BP1_Tudor-1xniJ06 J:1485-1602                                                                                       Pfam domains (6)
           Pfam domains (7) 53-BP1_Tudor-1xniJ07 J:1485-1602                                                                                       Pfam domains (7)
           Pfam domains (8) 53-BP1_Tudor-1xniJ08 J:1485-1602                                                                                       Pfam domains (8)
           Pfam domains (9) 53-BP1_Tudor-1xniJ09 J:1485-1602                                                                                       Pfam domains (9)
          Pfam domains (10) 53-BP1_Tudor-1xniJ10 J:1485-1602                                                                                       Pfam domains (10)
         Sec.struct. author .....eeee........eeeeeeee....eeeeee....eeeee...ee.........eeee........eeeeeeeee....eeeeeee..eeeeee...ee.hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---W------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.24a  PDB: J:1485-1556 UniProt: 1412-1556 [INCOMPLETE]            ---------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------Exon 1.25b  PDB: J:1556-1602 UniProt: 1556-1620 Transcript 1 (2)
                1xni J 1485 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL 1602
                                  1494      1504      1514      1524      1534      1544      1554      1564      1574      1584      1594

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: SH3-like barrel (1035)

Superfamily: Tudor/PWWP/MBT (72)

Family: Tudor domain (24)

Protein domain: p53-binding protein 1, 53BP1 (5)

Human (Homo sapiens) [TaxId: 9606] (5)

1a	d1xnia1	A:1485-1537
1b	d1xnid1	D:1485-1537
1c	d1xnid2	D:1538-1602
1d	d1xnie1	E:1485-1537
1e	d1xnie2	E:1538-1602
1f	d1xnif1	F:1485-1537
1g	d1xnif2	F:1538-1602
1h	d1xnig1	G:1485-1537
1i	d1xnig2	G:1538-1602
1j	d1xnih1	H:1485-1537
1k	d1xnih2	H:1538-1602
1l	d1xnii1	I:1485-1537
1m	d1xnii2	I:1538-1602
1n	d1xnij1	J:1485-1537
1o	d1xnij2	J:1538-1602
1p	d1xnia2	A:1538-1602
1q	d1xnib1	B:1485-1537
1r	d1xnib2	B:1538-1602
1s	d1xnic1	C:1485-1537
1t	d1xnic2	C:1538-1602

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Roll (1513)

Topology: SH3 type barrels. (648)

Homologous Superfamily: [code=2.30.30.140, no name defined] (12)

Human (Homo sapiens) (10)

1a	1xniA01	A:1485-1538
1b	1xniI01	I:1485-1538
1c	1xniJ01	J:1485-1538
1d	1xniB01	B:1485-1538
1e	1xniC01	C:1485-1538
1f	1xniD01	D:1485-1538
1g	1xniE01	E:1485-1538
1h	1xniF01	F:1485-1538
1i	1xniG01	G:1485-1538
1j	1xniH01	H:1485-1538

Homologous Superfamily: [code=2.30.30.30, no name defined] (111)

Human (Homo sapiens) (10)

2a	1xniA02	A:1539-1602
2b	1xniG02	G:1539-1602
2c	1xniH02	H:1539-1602
2d	1xniI02	I:1539-1602
2e	1xniJ02	J:1539-1602
2f	1xniB02	B:1539-1602
2g	1xniC02	C:1539-1602
2h	1xniD02	D:1539-1602
2i	1xniE02	E:1539-1602
2j	1xniF02	F:1539-1602

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Tudor (88)

Family: 53-BP1_Tudor (5)

Homo sapiens (Human) (4)

1a	53-BP1_Tudor-1xniJ01	J:1485-1602
1b	53-BP1_Tudor-1xniJ02	J:1485-1602
1c	53-BP1_Tudor-1xniJ03	J:1485-1602
1d	53-BP1_Tudor-1xniJ04	J:1485-1602
1e	53-BP1_Tudor-1xniJ05	J:1485-1602
1f	53-BP1_Tudor-1xniJ06	J:1485-1602
1g	53-BP1_Tudor-1xniJ07	J:1485-1602
1h	53-BP1_Tudor-1xniJ08	J:1485-1602
1i	53-BP1_Tudor-1xniJ09	J:1485-1602
1j	53-BP1_Tudor-1xniJ10	J:1485-1602

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F,G,H,I,J (TP53B_HUMAN | Q12888)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0001102	RNA polymerase II activating transcription factor binding	Interacting selectively and non-covalently with an RNA polymerase II transcription activating factor, a protein involved in positive regulation of transcription.
	GO:0001104	RNA polymerase II transcription cofactor activity	Interacting selectively and non-covalently with an RNA polymerase II (RNAP II) regulatory transcription factor and also with the RNAP II basal transcription machinery in order to modulate transcription. Cofactors generally do not bind DNA, but rather mediate protein-protein interactions between regulatory transcription factors and the basal RNAP II transcription machinery.
	GO:0035064	methylated histone binding	Interacting selectively and non-covalently with a histone in which a residue has been modified by methylation. Histones are any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes.
	GO:0002039	p53 binding	Interacting selectively and non-covalently with one of the p53 family of proteins.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0000077	DNA damage checkpoint	A cell cycle checkpoint that regulates progression through the cell cycle in response to DNA damage. A DNA damage checkpoint may blocks cell cycle progression (in G1, G2 or metaphase) or slow the rate at which S phase proceeds.
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0071481	cellular response to X-ray	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of X-ray radiation. An X-ray is a form of electromagnetic radiation with a wavelength in the range of 10 nanometers to 100 picometers (corresponding to frequencies in the range 30 PHz to 3 EHz).
	GO:0006303	double-strand break repair via nonhomologous end joining	The repair of a double-strand break in DNA in which the two broken ends are rejoined with little or no sequence complementarity. Information at the DNA ends may be lost due to the modification of broken DNA ends. This term covers instances of separate pathways, called classical (or canonical) and alternative nonhomologous end joining (C-NHEJ and A-NHEJ). These in turn may further branch into sub-pathways, but evidence is still unclear.
	GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	Any process that activates or increases the frequency, rate or extent of activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0016925	protein sumoylation	The process in which a SUMO protein (small ubiquitin-related modifier) is conjugated to a target protein via an isopeptide bond between the carboxyl terminus of SUMO with an epsilon-amino group of a lysine residue of the target protein.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005694	chromosome	A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
	GO:0000775	chromosome, centromeric region	The region of a chromosome that includes the centromeric DNA and associated proteins. In monocentric chromosomes, this region corresponds to a single area of the chromosome, whereas in holocentric chromosomes, it is evenly distributed along the chromosome.
	GO:0000781	chromosome, telomeric region	The terminal region of a linear chromosome that includes the telomeric DNA repeats and associated proteins.
	GO:0000777	condensed chromosome kinetochore	A multisubunit complex that is located at the centromeric region of a condensed chromosome and provides an attachment point for the spindle microtubules.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0000776	kinetochore	A multisubunit complex that is located at the centromeric region of DNA and provides an attachment point for the spindle microtubules.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1xni)

	Sites
(no "Sites" information available for 1xni)

	Cis Peptide Bonds
		Asp A:1536 - Pro A:1537	[ RasMol ]
		Asp B:1536 - Pro B:1537	[ RasMol ]
		Asp C:1536 - Pro C:1537	[ RasMol ]
		Asp D:1536 - Pro D:1537	[ RasMol ]
		Asp E:1536 - Pro E:1537	[ RasMol ]
		Asp F:1536 - Pro F:1537	[ RasMol ]
		Asp G:1536 - Pro G:1537	[ RasMol ]
		Asp H:1536 - Pro H:1537	[ RasMol ]
		Asp I:1536 - Pro I:1537	[ RasMol ]
		Asp J:1536 - Pro J:1537	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]
		Biological Unit 6	[ Jena3D ]
		Biological Unit 7	[ Jena3D ]
		Biological Unit 8	[ Jena3D ]
		Biological Unit 9	[ Jena3D ]
		Biological Unit 10	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format \| Biol. Unit 5 PNG format \| Biol. Unit 6 PNG format \| Biol. Unit 7 PNG format \| Biol. Unit 8 PNG format \| Biol. Unit 9 PNG format \| Biol. Unit 10 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1xni
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	TP53B_HUMAN \| Q12888
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	TP53B_HUMAN \| Q12888
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1XNI)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (10, 10)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 10)

PROSITE Motifs (0, 0)

Exons (2, 20)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 20)

CATH Domains (2, 20)

Pfam Domains (1, 10)

Gene Ontology (25, 25)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File