Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  DEEP CLASSIFICATION OF A LARGE CRYO-EM DATASET DEFINES THE CONFORMATIONAL LANDSCAPE OF THE 26S PROTEASOME
 
Authors :  P. Unverdorben, F. Beck, P. Sledz, A. Schweitzer, G. Pfeifer, J. M. Plit W. Baumeister, F. Foerster
Date :  25 Feb 14  (Deposition) - 02 Apr 14  (Release) - 30 Apr 14  (Revision)
Method :  ELECTRON MICROSCOPY
Resolution :  8.80
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,1,2,3,4,5,6,7
Keywords :  Hydrolase, Aaa-Atpase, Atp-Analog, Classification (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  P. Unverdorben, F. Beck, P. Sledz, A. Schweitzer, G. Pfeifer, J. M. Plitzko, W. Baumeister, F. Forster
Deep Classification Of A Large Cryo-Em Dataset Defines The Conformational Landscape Of The 26S Proteasome.
Proc. Natl. Acad. Sci. Usa V. 111 5544 2014
PubMed-ID: 24706844  |  Reference-DOI: 10.1073/PNAS.1403409111

(-) Compounds

Molecule 1 - PROTEASOME COMPONENT PRE3
    Chains1
    EC Number3.4.25.1
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    Synonym20S PROTEASOME BETA SUBUNIT 1, MACROPAIN SUBUNIT PRE3, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT PRE3, PROTEINASE YSCE SUBUNIT PRE3
 
Molecule 2 - PROTEASOME COMPONENT PUP1
    Chains2
    EC Number3.4.25.1
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    Synonym20S PROTEASOME BETA SUBUNIT 2 MACROPAIN SUBUNIT PUP1, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT PUP1, PROTEINASE YSCE SUBUNIT PUP1
 
Molecule 3 - PROTEASOME COMPONENT PUP3
    Chains3
    EC Number3.4.25.1
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    Synonym20S PROTEASOME BETA SUBUNIT 3, MACROPAIN SUBUNIT PUP3, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT PUP3
 
Molecule 4 - PROTEASOME COMPONENT C11
    Chains4
    EC Number3.4.25.1
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    Synonym20S PROTEASOME BETA SUBUNIT 4, MACROPAIN SUBUNIT C11, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT C11, PROTEINASE YSCE SUBUNIT 11
 
Molecule 5 - PROTEASOME COMPONENT PRE2
    Chains5
    EC Number3.4.25.1
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    Synonym20S PROTEASOME BETA SUBUNIT 5, MACROPAIN SUBUNIT PRE2, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT PRE2, PROTEINASE YSCE SUBUNIT PRE2
 
Molecule 6 - PROTEASOME COMPONENT C5
    Chains6
    EC Number3.4.25.1
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    Synonym20S PROTEASOME BETA SUBUNIT 6, MULTICATALYTIC ENDOPEPTIDASE
 
Molecule 7 - PROTEASOME COMPONENT PRE4
    Chains7
    EC Number3.4.25.1
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    Synonym20S PROTEASOME BETA SUBUNIT 7, MACROPAIN SUBUNIT PRE4, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT PRE4, PROTEINASE YSCE SUBUNIT PRE4
 
Molecule 8 - PROTEASOME COMPONENT C7-ALPHA
    ChainsA
    EC Number3.4.25.1
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    Synonym20S PROTEASOME ALPHA SUBUNIT 1, MACROPAIN SUBUNIT C7-ALPHA, MULTICATALYTIC ENDOPEPTIDASE COMPLEX C7, PROTEASOME COMPONENT Y8, PROTEINASE YSCE SUBUNIT 7, SCL1 SUPPRESSOR PROTEIN
 
Molecule 9 - PROTEASOME COMPONENT Y7
    ChainsB
    EC Number3.4.25.1
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    Synonym20S PROTEASOME ALPHA SUBUNIT 2, MACROPAIN SUBUNIT Y7, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT Y7, PROTEINASE YSCE SUBUNIT 7
 
Molecule 10 - PROTEASOME COMPONENT Y13
    ChainsC
    EC Number3.4.25.1
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    Synonym20S PROTEASOME ALPHA SUBUNIT 3, MACROPAIN SUBUNIT Y13, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT Y13, PROTEINASE YSCE SUBUNIT 13
 
Molecule 11 - PROTEASOME COMPONENT PRE6
    ChainsD
    EC Number3.4.25.1
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    Synonym20S PROTEASOME ALPHA SUBUNIT 4, MACROPAIN SUBUNIT PRE6, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT PRE6, PROTEINASE YSCE SUBUNIT PRE6
 
Molecule 12 - PROTEASOME COMPONENT PUP2
    ChainsE
    EC Number3.4.25.1
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    Synonym20S PROTEASOME ALPHA SUBUNIT 5, MACROPAIN SUBUNIT PUP2, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT PUP2, PROTEINASE YSCE SUBUNIT PUP2
 
Molecule 13 - PROTEASOME COMPONENT PRE5
    ChainsF
    EC Number3.4.25.1
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    Synonym20S PROTEASOME ALPHA SUBUNIT 6, MACROPAIN SUBUNIT PRE5, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT PRE5, PROTEINASE YSCE SUBUNIT PRE5
 
Molecule 14 - PROTEASOME COMPONENT C1
    ChainsG
    EC Number3.4.25.1
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    Synonym20S PROTEASOME ALPHA SUBUNIT 7, MACROPAIN SUBUNIT C1, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT C1, PROTEINASE YSCE SUBUNIT 1
 
Molecule 15 - 26S PROTEASE REGULATORY SUBUNIT 7 HOMOLOG
    ChainsH
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymRPT1, PROTEIN CIM5, TAT-BINDING HOMOLOG 3
 
Molecule 16 - 26S PROTEASE REGULATORY SUBUNIT 4 HOMOLOG
    ChainsI
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymRPT2, TAT-BINDING HOMOLOG 5
 
Molecule 17 - 26S PROTEASE REGULATORY SUBUNIT 8 HOMOLOG
    ChainsJ
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymRPT6, PROTEIN CIM3, PROTEIN SUG1, TAT-BINDING PROTEIN TBY1
 
Molecule 18 - 26S PROTEASE REGULATORY SUBUNIT 6B HOMOLOG
    ChainsK
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymRPT3, PROTEIN YNT1, TAT-BINDING HOMOLOG 2
 
Molecule 19 - 26S PROTEASE SUBUNIT RPT4
    ChainsL
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymRPT4,26S PROTEASE SUBUNIT SUG2, PROTEASOMAL CAP SUBUNIT
 
Molecule 20 - 26S PROTEASE REGULATORY SUBUNIT 6A
    ChainsM
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymRPT5, TAT-BINDING PROTEIN HOMOLOG 1, TBP-1
 
Molecule 21 - 26S PROTEASOME REGULATORY SUBUNIT RPN2
    ChainsN
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymRPN2
 
Molecule 22 - 26S PROTEASOME REGULATORY SUBUNIT RPN9
    ChainsO
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymRPN9, PROTEASOME NON-ATPASE SUBUNIT 7
 
Molecule 23 - 26S PROTEASOME REGULATORY SUBUNIT RPN5
    ChainsP
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymRPN5, PROTEASOME NON-ATPASE SUBUNIT 5
 
Molecule 24 - 26S PROTEASOME REGULATORY SUBUNIT RPN6
    ChainsQ
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymRPN6, PROTEASOME NON-ATPASE SUBUNIT 4
 
Molecule 25 - 26S PROTEASOME REGULATORY SUBUNIT RPN7
    ChainsR
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymRPN7
 
Molecule 26 - 26S PROTEASOME REGULATORY SUBUNIT RPN3
    ChainsS
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymRPN3
 
Molecule 27 - 26S PROTEASOME REGULATORY SUBUNIT RPN12
    ChainsT
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymRPN12, NUCLEAR INTEGRITY PROTEIN 1
 
Molecule 28 - 26S PROTEASOME REGULATORY SUBUNIT RPN8
    ChainsU
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymRPN8
 
Molecule 29 - 26S PROTEASOME REGULATORY SUBUNIT RPN11
    ChainsV
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymRPN11, PROTEIN MPR1
 
Molecule 30 - 26S PROTEASOME REGULATORY SUBUNIT RPN10
    ChainsW
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymRPN10
 
Molecule 31 - 26S PROTEASOME REGULATORY SUBUNIT RPN13
    ChainsX
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymRPN13, PROTEASOME NON-ATPASE SUBUNIT 13
 
Molecule 32 - 26S PROTEASOME COMPLEX SUBUNIT SEM1
    ChainsY
    FragmentSEM1
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
 
Molecule 33 - 26S PROTEASOME REGULATORY SUBUNIT RPN1
    ChainsZ
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymHMG-COA REDUCTASE DEGRADATION PROTEIN 2, PROTEASOME NON-ATPASE SUBUNIT 1

 Structural Features

(-) Chains, Units

  123456789101112131415161718192021222324252627282930313233
Asymmetric/Biological Unit ABCDEFGHIJKLMNOPQRSTUVWXYZ1234567

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4CR4)

(-) Sites  (0, 0)

(no "Site" information available for 4CR4)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4CR4)

(-) Cis Peptide Bonds  (9, 9)

Asymmetric/Biological Unit
No.Residues
1Asn I:102 -Pro I:103
2Ala I:275 -Pro I:276
3Ala J:241 -Pro J:242
4Val K:92 -Pro K:93
5Ala K:265 -Pro K:266
6Leu M:75 -Pro M:76
7Ala M:274 -Pro M:275
8Gly U:96 -Pro U:97
9Pro W:22 -Arg W:23

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (3, 3)

Asymmetric/Biological Unit (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_RPN11_YEAST_001 *K208QRPN11_YEAST  ---  ---VK208Q
2UniProtVAR_RPN11_YEAST_002 *A239TRPN11_YEAST  ---  ---VA239T
3UniProtVAR_RPN11_YEAST_003 *T262SRPN11_YEAST  ---  ---VT262S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (8, 33)

Asymmetric/Biological Unit (8, 33)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEASOME_BETA_2PS51476 Proteasome beta-type subunit profile.PSB4_YEAST1-184  14:-1-183
PSB3_YEAST9-190  13:-1-181
PSB1_YEAST19-197  11:-1-178
PSB6_YEAST28-226  16:-1-198
PSB7_YEAST41-233  17:-1-192
2PROTEASOME_ALPHA_1PS00388 Proteasome alpha-type subunits signature.PSA4_YEAST4-26  1D:4-26
PSA2_YEAST5-27  1B:5-27
PSA6_YEAST6-28  1F:6-28
PSA3_YEAST6-28  1C:6-28
PSA7_YEAST8-30  1G:7-29
PSA1_YEAST12-34  1A:12-34
3VWFAPS50234 VWFA domain profile.RPN10_YEAST5-190  1W:5-190
4PROTEASOME_BETA_1PS00854 Proteasome beta-type subunits signature.PSB4_YEAST5-52  14:4-51
PSB3_YEAST13-59  13:4-50
PSB1_YEAST23-70  11:4-51
PSB6_YEAST32-79  16:4-51
PSB2_YEAST33-80  12:4-51
PSB7_YEAST45-92  17:4-51
PSB5_YEAST79-126  15:4-51
5PROTEASOME_ALPHA_2PS51475 Proteasome alpha-type subunit profile.PSA4_YEAST19-233  1D:19-233
PSA2_YEAST20-247  1B:20-247
PSA6_YEAST21-234  1F:21-234
PSA3_YEAST21-239  1C:21-239
PSA5_YEAST23-240  1E:23-240
PSA7_YEAST23-240  1G:22-239
PSA1_YEAST27-245  1A:27-245
6TPRPS50005 TPR repeat profile.RPN7_YEAST131-164  1R:131-164
7TPR_REGIONPS50293 TPR repeat region circular profile.RPN7_YEAST131-164  1R:131-164
8AAAPS00674 AAA-protein family signature.PRS8_YEAST288-306  1J:288-306
PRS6B_YEAST312-330  1K:312-330
PRS10_YEAST321-339  1L:321-339
PRS6A_YEAST321-339  1M:321-339
PRS4_YEAST322-340  1I:322-340
PRS7_YEAST349-367  1H:349-367

(-) Exons   (16, 16)

Asymmetric/Biological Unit (16, 16)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1YBL041W1YBL041W.1II:141250-141975726PSB6_YEAST1-24124116:-9-213222

2.1YDR394W1YDR394W.1IV:1261674-12629601287PRS6B_YEAST1-4284281K:48-428381

3.1YER012W1YER012W.1V:177834-178430597PSB4_YEAST1-19819814:-1-197198

4.1YER094C1YER094C.1V:349342-348725618PSB3_YEAST1-20520513:-8-196204

5.1YFR050C1YFR050C.1VI:249853-249053801PSB7_YEAST1-26626617:-8-225233

6.1YGL011C1YGL011C.1VII:475252-474494759PSA1_YEAST1-2522521A:10-252243

7.1YGR135W1YGR135W.1VII:761397-762173777PSA3_YEAST1-2582581C:2-246245

8.1YGR253C1YGR253C.1VII:999145-998363783PSA5_YEAST1-2602601E:9-251243

9.1YJL001W1YJL001W.1X:435156-43522065PSB1_YEAST1-222211:-9-312
9.2YJL001W2YJL001W.2X:435337-435919583PSB1_YEAST22-21519411:3-196194

10.1YML092C1YML092C.1XIII:86739-85987753PSA2_YEAST1-2502501B:1-250250

11.1YMR314W1YMR314W.1XIII:901708-902412705PSA6_YEAST1-2342341F:2-234233

12.1YOL038W1YOL038W.1XV:255336-256100765PSA4_YEAST1-2542541D:3-244242

13.1YOR157C1YOR157C.1XV:631752-630967786PSB2_YEAST1-26126112:1-223223

14.1YOR362C1YOR362C.1XV:1018744-1017878867PSA7_YEAST1-2882881G:4-248245

15.1YPR103W1YPR103W.1XVI:732347-733210864PSB5_YEAST1-28728715:1-212212

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain 1 from PDB  Type:PROTEIN  Length:205
 aligned with PSB1_YEAST | P38624 from UniProtKB/Swiss-Prot  Length:215

    Alignment length:205
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210     
           PSB1_YEAST    11 LKKGEVSLGTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL 215
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eeeeee....eeeeee..eee..eeee.....eeeee..eeeeeeehhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.....eeeeeeee.....eeeeee......eee..eeee.hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh......eeeeeee..eeeeeeehhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (12)
               PROSITE (13) --------PROTEASOME_BETA_2  PDB: 1:-1-178 UniProt: 19-197                                                                                                                                   ------------------ PROSITE (13)
               PROSITE (14) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (14)
               PROSITE (15) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (15)
               PROSITE (16) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (16)
               PROSITE (17) ------------PROTEASOME_BETA_1  PDB: 1:4-51 UniProt: 23-70   ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (17)
           Transcript 9 (1) Exon 9.1    ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 9 (1)
           Transcript 9 (2) -----------Exon 9.2  PDB: 1:3-196 UniProt: 22-215                                                                                                                                                             Transcript 9 (2)
                 4cr4 1  -9 LKKGEVSLGTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL 196
                                    |1        11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191     
                                   -1|                                                                                                                                                                                                   
                                     1                                                                                                                                                                                                   

Chain 2 from PDB  Type:PROTEIN  Length:223
 aligned with PSB2_YEAST | P25043 from UniProtKB/Swiss-Prot  Length:261

    Alignment length:223
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249   
           PSB2_YEAST    30 TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICDI 252
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee..eeeeeee..eee..eeee.....eeeee..eeeeeeehhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.....eeeeeeeee..eeeeeee.....eee..eeeee.hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh......eeeeeee.....eeeeeee....................eeeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---PROTEASOME_BETA_1  PDB: 2:4-51 UniProt: 33-80   ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
              Transcript 13 Exon 13.1  PDB: 2:1-223 UniProt: 1-261 [INCOMPLETE]                                                                                                                                                                             Transcript 13
                 4cr4 2   1 TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICDI 223
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220   

Chain 3 from PDB  Type:PROTEIN  Length:204
 aligned with PSB3_YEAST | P25451 from UniProtKB/Swiss-Prot  Length:205

    Alignment length:204
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201    
           PSB3_YEAST     2 SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD 205
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .........eeeeee...eeeeeee..eee..eeee.....eeee..eeee...hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh..........eeeee......eeeee.......eee..eeeee.hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh........eeeeeee...eeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (5)
                PROSITE (6) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (6)
                PROSITE (7) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (7)
                PROSITE (8) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (8)
                PROSITE (9) -------PROTEASOME_BETA_2  PDB: 3:-1-181 UniProt: 9-190                                                                                                                                       --------------- PROSITE (9)
               PROSITE (10) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (10)
               PROSITE (11) -----------PROTEASOME_BETA_1  PDB: 3:4-50 UniProt: 13-59  -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               Transcript 4 Exon 4.1  PDB: 3:-8-196 UniProt: 1-205 [INCOMPLETE]                                                                                                                                                          Transcript 4
                 4cr4 3  -8 SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD 196
                                   ||2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192    
                                  -1|                                                                                                                                                                                                   
                                    1                                                                                                                                                                                                   

Chain 4 from PDB  Type:PROTEIN  Length:198
 aligned with PSB4_YEAST | P22141 from UniProtKB/Swiss-Prot  Length:198

    Alignment length:198
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190        
           PSB4_YEAST     1 MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ 198
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee....eeeeee..eee..eeee.....eeeee..eeeeeeehhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.......eeeeeeeee....eeeeeee.....eee..eee..hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh......eeeeeee..eeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) PROTEASOME_BETA_2  PDB: 4:-1-183 UniProt: 1-184                                                                                                                                         -------------- PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) ----PROTEASOME_BETA_1  PDB: 4:4-51 UniProt: 5-52    -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
               Transcript 3 Exon 3.1  PDB: 4:-1-197 UniProt: 1-198                                                                                                                                                                 Transcript 3
                 4cr4 4  -1 MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ 197
                            ||       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189        
                           -1|                                                                                                                                                                                                    
                             1                                                                                                                                                                                                    

Chain 5 from PDB  Type:PROTEIN  Length:212
 aligned with PSB5_YEAST | P30656 from UniProtKB/Swiss-Prot  Length:287

    Alignment length:212
                                    85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285  
           PSB5_YEAST    76 TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG 287
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..eeeeeeee.eee..eeee.....eee....eeee...hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.......eeeeeeee...eeeeeeee....eee..eeee..hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh.....eeeeeeee..eeeeeeeeehhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ---PROTEASOME_BETA_1  PDB: 5:4-51 UniProt: 79-126  ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
              Transcript 15 Exon 15.1  PDB: 5:1-212 UniProt: 1-287 [INCOMPLETE]                                                                                                                                                                  Transcript 15
                 4cr4 5   1 TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKRVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG 212
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210  

Chain 6 from PDB  Type:PROTEIN  Length:222
 aligned with PSB6_YEAST | P23724 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:222
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239  
           PSB6_YEAST    20 QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD 241
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..........eeeeee....eeeeee..eee..eeee.....eee....eeeeeeehhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh.......eeeeeeee.....eeeeee.....eee..eeeee.hhhhhhhhhhhhh.....................hhhhhhhhhhhhhhhhhhhh.....eeeeeeee..eeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) --------PROTEASOME_BETA_2  PDB: 6:-1-198 UniProt: 28-226                                                                                                                                                       --------------- PROSITE (3)
                PROSITE (4) ------------PROTEASOME_BETA_1  PDB: 6:4-51 UniProt: 32-79   ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
               Transcript 1 Exon 1.1  PDB: 6:-9-213 UniProt: 1-241 [INCOMPLETE]                                                                                                                                                                            Transcript 1
                 4cr4 6  -9 QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD 213
                                    |1        11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211  
                                   -1|                                                                                                                                                                                                                    
                                     1                                                                                                                                                                                                                    

Chain 7 from PDB  Type:PROTEIN  Length:233
 aligned with PSB7_YEAST | P30657 from UniProtKB/Swiss-Prot  Length:266

    Alignment length:233
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263   
           PSB7_YEAST    34 TQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLLKDLVTENAYDNPLADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAGVQSNGDQFLRYVNLLGVTYSSPTLATGFGAHMANPLLRKVVDRESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKNLQVENMKWDFAKDIKGYGTQKI 266
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......ee..eeeeee..eeeeeee.eeee..eeeee....eeee...eeeeeeeehhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhh.....eeeeeeee.....eeeeeee....ee...eee..hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeeee...eeeeeeeee.....hhhhh.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) -------PROTEASOME_BETA_2  PDB: 7:-1-192 UniProt: 41-233                                                                                                                                                 --------------------------------- PROSITE (6)
                PROSITE (7) -----------PROTEASOME_BETA_1  PDB: 7:4-51 UniProt: 45-92   ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (7)
               Transcript 5 Exon 5.1  PDB: 7:-8-225 UniProt: 1-266 [INCOMPLETE]                                                                                                                                                                                       Transcript 5
                 4cr4 7  -8 TQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLLKDLVTENAYDNPLADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAGVQSNGDQFLRYVNLLGVTYSSPTLATGFGAHMANPLLRKVVDRESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKNLQVENMKWDFAKDIKGYGTQKI 225
                                   ||2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222   
                                  -1|                                                                                                                                                                                                                                
                                    1                                                                                                                                                                                                                                

Chain A from PDB  Type:PROTEIN  Length:243
 aligned with PSA1_YEAST | P21243 from UniProtKB/Swiss-Prot  Length:252

    Alignment length:243
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249   
           PSA1_YEAST    10 AGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIAEQD 252
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............hhhhhhhhhh.......eeeee....eeeeee...............eee.....eeeee.hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh........eeeeeeee...eeeeeeee...eeee...eee..hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh...hhh.eeeeeee..eeeeehhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----------------PROTEASOME_ALPHA_2  PDB: A:27-245 UniProt: 27-245                                                                                                                                                                          ------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) --PROTEASOME_ALPHA_1     -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               Transcript 6 Exon 6.1  PDB: A:10-252 UniProt: 1-252 [INCOMPLETE]                                                                                                                                                                                                 Transcript 6
                 4cr4 A  10 AGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIAEQD 252
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249   

Chain B from PDB  Type:PROTEIN  Length:250
 aligned with PSA2_YEAST | P23639 from UniProtKB/Swiss-Prot  Length:250

    Alignment length:250
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250
           PSA2_YEAST     1 MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL 250
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .................hhhhhhhhhhhhh...eeeee....eeeeee................eeee..eeeeeeehhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhh.......eeeeeeeee...eeeeeee.....eee..eeee..hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh....hhh.eeeeee...hhhhh............eee.hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----PROTEASOME_ALPHA_1     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (12)
               PROSITE (13) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (13)
               PROSITE (14) -------------------PROTEASOME_ALPHA_2  PDB: B:20-247 UniProt: 20-247                                                                                                                                                                                   --- PROSITE (14)
              Transcript 10 Exon 10.1  PDB: B:1-250 UniProt: 1-250                                                                                                                                                                                                                     Transcript 10
                 4cr4 B   1 MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL 250
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250

Chain C from PDB  Type:PROTEIN  Length:245
 aligned with PSA3_YEAST | P23638 from UniProtKB/Swiss-Prot  Length:258

    Alignment length:245
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241     
           PSA3_YEAST     2 GSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGITK 246
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .................hhhhhhhhhhhh....eeeee...eeeeeee................eee....eeeeeeehhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.......eeeeeeeee...eeeeeee.....eee..eeee..hhhhhhhhhhhhh....hhhhhhhhhhhhhhhh......hhh.eeeeeee........eeeeehhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ----PROTEASOME_ALPHA_1     -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (14)
               PROSITE (15) -------------------PROTEASOME_ALPHA_2  PDB: C:21-239 UniProt: 21-239                                                                                                                                                                          ------- PROSITE (15)
               Transcript 7 Exon 7.1  PDB: C:2-246 UniProt: 1-258 [INCOMPLETE]                                                                                                                                                                                                    Transcript 7
                 4cr4 C   2 GSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGITK 246
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241     

Chain D from PDB  Type:PROTEIN  Length:242
 aligned with PSA4_YEAST | P40303 from UniProtKB/Swiss-Prot  Length:254

    Alignment length:242
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242  
           PSA4_YEAST     3 GYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQQ 244
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhhhhhhhhhhh.eeeeee....eeeeee.................eeee..eeeeeeehhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.......eeeeeee........eeeee.....eee..eeeee.hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh.....eeeeeee...eee..hhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -PROTEASOME_ALPHA_1     -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------PROTEASOME_ALPHA_2  PDB: D:19-233 UniProt: 19-233                                                                                                                                                                      ----------- PROSITE (12)
              Transcript 12 Exon 12.1  PDB: D:3-244 UniProt: 1-254 [INCOMPLETE]                                                                                                                                                                                                Transcript 12
                 4cr4 D   3 GYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQQ 244
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242  

Chain E from PDB  Type:PROTEIN  Length:243
 aligned with PSA5_YEAST | P32379 from UniProtKB/Swiss-Prot  Length:260

    Alignment length:243
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248   
           PSA5_YEAST     9 DRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAES 251
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhh..eeeee....eeeee................eeeee..eeeeeee..hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh....................eeeeeeeee...eeeeeee.....eeee.eeee..hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh.........eeeeee...eee..hhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (12)
               PROSITE (13) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (13)
               PROSITE (14) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (14)
               PROSITE (15) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (15)
               PROSITE (16) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (16)
               PROSITE (17) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (17)
               PROSITE (18) --------------PROTEASOME_ALPHA_2  PDB: E:23-240 UniProt: 23-240                                                                                                                                                                         ----------- PROSITE (18)
               Transcript 8 Exon 8.1  PDB: E:9-251 UniProt: 1-260 [INCOMPLETE]                                                                                                                                                                                                  Transcript 8
                 4cr4 E   9 DRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAES 251
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248   

Chain F from PDB  Type:PROTEIN  Length:233
 aligned with PSA6_YEAST | P40302 from UniProtKB/Swiss-Prot  Length:234

    Alignment length:233
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231   
           PSA6_YEAST     2 FRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI 234
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh............hhhhhhhhhhhh....eeeee...eeeeeee.............eeeee..eeeeeeehhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh..........eeeeeeeee..eeeeeee......ee..eeee..hhhhhhhhhh.hhhhhhh...hhhhhhhhhhhhhhhhh.........eeeeeee.....eeee.hhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ----PROTEASOME_ALPHA_1     -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (15)
               PROSITE (16) -------------------PROTEASOME_ALPHA_2  PDB: F:21-234 UniProt: 21-234                                                                                                                                                                      PROSITE (16)
              Transcript 11 Exon 11.1  PDB: F:2-234 UniProt: 1-234 [INCOMPLETE]                                                                                                                                                                                       Transcript 11
                 4cr4 F   2 FRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI 234
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231   

Chain G from PDB  Type:PROTEIN  Length:245
 aligned with PSA7_YEAST | P21242 from UniProtKB/Swiss-Prot  Length:288

    Alignment length:245
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244     
           PSA7_YEAST     5 GTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEING 249
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhhhhhhh...eeeee...eeeeeeeeee.............eee...eeeeeeehhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh..........eeeeeeeee..eeeeeee.....eeee.eeee..hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...eeeeeeeeee.......eeee.hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ---PROTEASOME_ALPHA_1     --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                PROSITE (9) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (9)
               PROSITE (10) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (10)
               PROSITE (11) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (11)
               PROSITE (12) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (12)
               PROSITE (13) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (13)
               PROSITE (14) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (14)
               PROSITE (15) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (15)
               PROSITE (16) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (16)
               PROSITE (17) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (17)
               PROSITE (18) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (18)
               PROSITE (19) ------------------PROTEASOME_ALPHA_2  PDB: G:22-239 UniProt: 23-240                                                                                                                                                                         --------- PROSITE (19)
              Transcript 14 Exon 14.1  PDB: G:4-248 UniProt: 1-288 [INCOMPLETE]                                                                                                                                                                                                   Transcript 14
                 4cr4 G   4 GTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEING 248
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243     

Chain H from PDB  Type:PROTEIN  Length:359
 aligned with PRS7_YEAST | P33299 from UniProtKB/Swiss-Prot  Length:467

    Alignment length:408
                                    58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448        
           PRS7_YEAST    49 LKQTENDLKDIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGESDETTTDNNNSGNSNSNSNQQSTDADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKK 456
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhh...-----------------.....eeeee....--------------------------------.....eeee....eeee...............ee........................eeee...........hhhhhhhhhhhhhhhhhhhhhhhhhh.....eeee......hhhhhhhhhhhhhh.eeeeee.........hhhhhhhhhhhhhhhhh..eeeeee.................hhhhhhhhhhhhhhhhhh.....eeeee.......hhhhhh.....eee.....hhhhhhhhhhhhhh.........hhhhhhhh...hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AAA  PDB: H:349-367----------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4cr4 H  49 LKQTENDLKDIEARIKEKAGVKESDTGLA-----------------HPLQVARCTKIIKG--------------------------------EDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKK 456
                                    58        68        |-         -      | 98       108         -         -         -  |    148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448        
                                                       77                95          108                              141                                                                                                                                                                                                                                                                                                                           

Chain I from PDB  Type:PROTEIN  Length:362
 aligned with PRS4_YEAST | P40327 from UniProtKB/Swiss-Prot  Length:437

    Alignment length:362
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434  
           PRS4_YEAST    75 FVSNSEILKPFEKKQEEEKKQLEEIRGNPLSIGTLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLY 436
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeee....eeeee.....eeeee..............eeee......eeeee...........eeee....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhh.eeeeee.........hhhhhhhhhhhhhhhhh..eeeeee................hhhhhhhhhhhhhhhh.......eeeeee....................ee....hhhhhhhhhhhhhhh.......hhhhhhhhh...hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AAA  PDB: I:322-340------------------------------------------------------------------------------------------------ PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cr4 I  75 FVSNSEILKPFEKKQEEEKKQLEEIRGNPLSIGTLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLY 436
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434  

Chain J from PDB  Type:PROTEIN  Length:373
 aligned with PRS8_YEAST | Q01939 from UniProtKB/Swiss-Prot  Length:405

    Alignment length:373
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393   
           PRS8_YEAST    24 EQKIQETELKIRSKTENVRRLEAQRNALNDKVRFIKDELRLLQEPGSYVGEVIKIVSDKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKNQET 396
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeeee....eeeeee....eeeee.............eeeee......eeeeeee..........ee............hhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhh..eeeee.hhhh....hhhhhhhhhhhhhhhhh...eeeee.................hhhhhhhhhhhhhhh........eeeee..................eeee....hhhhhhhhhhhhh.........hhhhhhhhh...hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AAA  PDB: J:288-306------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cr4 J  24 EQKIQETELKIRSKTENVRRLEAQRNALNDKVRFIKDELRLLQEPGSYVGEVIKIVSDKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKNQET 396
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393   

Chain K from PDB  Type:PROTEIN  Length:381
 aligned with PRS6B_YEAST | P33298 from UniProtKB/Swiss-Prot  Length:428

    Alignment length:381
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427 
          PRS6B_YEAST    48 YFKLKKLEKEYELLTLQEDYIKDEQRHLKRELKRAQEEVKRIQSVPLVIGQFLEPIDQNTGIVSSTTGMSYVVRILSTLDRELLKPSMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVKTDNTVDKFDFYK 428
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeeeeee..eeeeee....eeee..............eeeee......eeeee...........eee............hhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhh..eeeeee.........hhhhhhhhhhhhhhhhh..eeeeeehhhhhhh..........hhhhhhhhhhhhhhhhh.....eeeeeee......hhhhhh...eeeeee.....hhhhhhhhhhhhhhhh......hhhhhhhhh...hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AAA  PDB: K:312-330-------------------------------------------------------------------------------------------------- PROSITE
               Transcript 2 Exon 2.1  PDB: K:48-428 UniProt: 1-428 [INCOMPLETE]                                                                                                                                                                                                                                                                                                                                           Transcript 2
                 4cr4 K  48 YFKLKKLEKEYELLTLQEDYIKDEQRHLKRELKRAQEEVKRIQSVPLVIGQFLEPIDQNTGIVSSTTGMSYVVRILSTLDRELLKPSMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVKTDNTVDKFDFYK 428
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427 

Chain L from PDB  Type:PROTEIN  Length:361
 aligned with PRS10_YEAST | P53549 from UniProtKB/Swiss-Prot  Length:437

    Alignment length:361
                                    76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426 
          PRS10_YEAST    67 HRRYDDQLKQRRQNIRDLEKLYDKTENDIKALQSIGQLIGEVMKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQGEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDLMKAVRKVAEVKK 427
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeee......eeeee....eeee...............eeee......eeee............eeee...........hhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhh.eeeeee.hhhh....hhhhhhhhhhhhhhhhh..eeeeee.................hhhhhhhhhhhhhhhh......eeeeeee.hhhhhhhhhhh.............hhhhhhhhhhhhhhh.......hhhhhhhh....hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AAA  PDB: L:321-339---------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cr4 L  67 HRRYDDQLKQRRQNIRDLEKLYDKTENDIKALQSIGQLIGEVMKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQGEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDLMKAVRKVAEVKK 427
                                    76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426 

Chain M from PDB  Type:PROTEIN  Length:367
 aligned with PRS6A_YEAST | P33297 from UniProtKB/Swiss-Prot  Length:434

    Alignment length:394
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430    
          PRS6A_YEAST    41 IRIFRSELQRLSHENNVMLEKIKDNKEKIKNNRQLPYLVANVVEVMDMNEIEDKENSESTTQGGNVNLDNTAVGKAAVVKTSSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQARKSKSVSFYA 434
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeee.---------------------------...eeeeee....eeeee...............eee......eeee............eee............hhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhh.eeeeeehhhhh....hhhhhhhhhhhhhhhhhh.eeeeee...........hhhhhhhhhhhhhhhhhhhhh.......eeeeeee...............eeeeee....hhhhhhhhhhhhhhhh......hhhhhhhhh...hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AAA  PDB: M:321-339----------------------------------------------------------------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cr4 M  41 IRIFRSELQRLSHENNVMLEKIKDNKEKIKNNRQLPYLVANVVEV---------------------------VGKAAVVKTSSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQARKSKSVSFYA 434
                                    50        60        70        80    |    -         -         -  |    120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430    
                                                                       85                         113                                                                                                                                                                                                                                                                                                                                 

Chain N from PDB  Type:PROTEIN  Length:849
 aligned with RPN2_YEAST | P32565 from UniProtKB/Swiss-Prot  Length:945

    Alignment length:922
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673       683       693       703       713       723       733       743       753       763       773       783       793       803       813       823       833       843       853       863       873       883       893       903       913       923  
           RPN2_YEAST     4 TTAAPLLALLRENQDSVKTYALESINNVVDQLWSEISNELPDIEALYDDDTFSDREMAALIASKVYYNLGEYESAVKYALAAKDRFDIDEKSQFVETIVSKSIEMYVQEASKQYTKDEQFYTKDIIDPKLTSIFERMIEKCLKASELKLALGIALEGYRLDIIESALKSKLDQDSTSENVKIINYLLTLAITTVTNSKFRSSILRKSFDFLMNMPNCDYLTLNKVVVNLNDAGLALQLFKKLKEENDEGLSAQIAFDLVSSASQQLLEILVTELTAQGYDPALLNILSGLPTCDYYNTFLLNNKNIDIGLLNKSKSSLDGKFSLFHTAVSVANGFMHAGTTDNSFIKANLPWLGKAQNWAKFTATASLGVIHKGNLLEGKKVMAPYLPGSRASSRFIKGGSLYGLGLIYAGFGRDTTDYLKNIIVENSGTSGDEDVDVLLHGASLGIGLAAMGSANIEVYEALKEVLYNDSATSGEAAALGMGLCMLGTGKPEAIHDMFTYSQETQHGNITRGLAVGLALINYGRQELADDLITKMLASDESLLRYGGAFTIALAYAGTGNNSAVKRLLHVAVSDSNDDVRRAAVIALGFVLLRDYTTVPRIVQLLSKSHNAHVRCGTAFALGIACAGKGLQSAIDVLDPLTKDPVDFVRQAAMIALSMILIQQTEKLNPQVADINKNFLSVITNKHQEGLAKFGACVAQGIMNAGGRNVTIQLENADTGTLDTKSVVGLVMFSQFWYWFPLAHFLSLSFTPTTVIGIRGSDQAIPKFQMNCYAKEDAFSYPRMYEEASGKEVEKVATAVLSTTARAKARAKKTKKEKGPNEEEKKKEHEEKEKERETNKKGIKETKENDEEFYKNKYSSKPYKVDNMTRILPQQSRYISFIKDDRFVPVRKFKGNNGVVVLRDREPKEPVALIETVRQMKD 925
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhh..hhhhhhhhhhhhhh....hhhhhh.hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh...hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhhhh...-hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhh.....hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhh......hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.....hhhhhhhhhh...hhhhhhhhhhhhhhhh....hhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.eee..........hhhhhhhhhhhh.......hhhhhhh.eee................................------------------------------------------------------------------------...............hhhhhh.........ee..............ee.................. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cr4 N   4 TTAAPLLALLRENQDSVKTYALESINNVVDQLWSEISNELPDIEALYDDDTFSDREMAALIASKVYYNLGEYESAVKYALAAKDRFDIDEKSQFVETIVSKSIEMYVQEASKQYTKDEQFYTKDIIDPKLTSIFERMIEKCLKASELKLALGIALEGYRLDIIESALKSKLDQ-STSENVKIINYLLTLAITTVTNSKFRSSILRKSFDFLMNMPNCDYLTLNKVVVNLNDAGLALQLFKKLKEENDEGLSAQIAFDLVSSASQQLLEILVTELTAQGYDPALLNILSGLPTCDYYNTFLLNNKNIDIGLLNKSKSSLDGKFSLFHTAVSVANGFMHAGTTDNSFIKANLPWLGKAQNWAKFTATASLGVIHKGNLLEGKKVMAPYLPGSRASSRFIKGGSLYGLGLIYAGFGRDTTDYLKNIIVENSGTSGDEDVDVLLHGASLGIGLAAMGSANIEVYEALKEVLYNDSATSGEAAALGMGLCMLGTGKPEAIHDMFTYSQETQHGNITRGLAVGLALINYGRQELADDLITKMLASDESLLRYGGAFTIALAYAGTGNNSAVKRLLHVAVSDSNDDVRRAAVIALGFVLLRDYTTVPRIVQLLSKSHNAHVRCGTAFALGIACAGKGLQSAIDVLDPLTKDPVDFVRQAAMIALSMILIQQTEKLNPQVADINKNFLSVITNKHQEGLAKFGACVAQGIMNAGGRNVTIQLENADTGTLDTKSVVGLVMFSQFWYWFPLAHFLSLSFTPTTVIGIRGSDQAIPKFQMNCYAKEDAFSYPRM------------------------------------------------------------------------KYSSKPYKVDNMTRILPQQSRYISFIKDDRFVPVRKFKGNNGVVVLRDREPKEPVALIETVRQMKD 925
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173  | |  183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673       683       693       703       713       723       733       743       753       763       773       783   |     -         -         -         -         -         -         -      |863       873       883       893       903       913       923  
                                                                                                                                                                                                      176 |                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              787                                                                      860                                                                 
                                                                                                                                                                                                        178                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           

Chain O from PDB  Type:PROTEIN  Length:387
 aligned with RPN9_YEAST | Q04062 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:387
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       
           RPN9_YEAST     1 MFNNHEIDTILSTLRMEADPSLHPLFEQFEKFYEEKLWFQLSESLTKFFDDAKSTPLRLRLYDNFVSKFYDKINQLSVVKYLLASLKDSKDFDESLKYLDDLKAQFQELDSKKQRNNGSKDHGDGILLIDSEIARTYLLKNDLVKARDLLDDLEKTLDKKDSIPLRITNSFYSTNSQYFKFKNDFNSFYYTSLLYLSTLEPSTSITLAERQQLAYDLSISALLGDKIYNFGELLHHPIMETIVNDSNYDWLFQLLNALTVGDFDKFDSLIKVQISKIPILAQHESFLRQKICLMTLIETVFVKNIRMLSFEDISKATHLPKDNVEHLVMRAISLGLLKGSIDQVNELVTISWVQPRIISGDQITKMKDRLVEWNDQVEKLGKKMEAR 387
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhh..........hhhhhhhhhh..........hhhhh........hhhhhhhhh.hhhhhh.hhhhhhhhhhhhhhh.hhhhhhhhhhhhh....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.....hhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeehhhhhhhhh.hhhhhhhhhhhhhhh...eeeee....eeeee.........hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cr4 O   1 MFNNHEIDTILSTLRMEADPSLHPLFEQFEKFYEEKLWFQLSESLTKFFDDAKSTPLRLRLYDNFVSKFYDKINQLSVVKYLLASLKDSKDFDESLKYLDDLKAQFQELDSKKQRNNGSKDHGDGILLIDSEIARTYLLKNDLVKARDLLDDLEKTLDKKDSIPLRITNSFYSTNSQYFKFKNDFNSFYYTSLLYLSTLEPSTSITLAERQQLAYDLSISALLGDKIYNFGELLHHPIMETIVNDSNYDWLFQLLNALTVGDFDKFDSLIKVQISKIPILAQHESFLRQKICLMTLIETVFVKNIRMLSFEDISKATHLPKDNVEHLVMRAISLGLLKGSIDQVNELVTISWVQPRIISGDQITKMKDRLVEWNDQVEKLGKKMEAR 387
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       

Chain P from PDB  Type:PROTEIN  Length:415
 aligned with RPN5_YEAST | Q12250 from UniProtKB/Swiss-Prot  Length:445

    Alignment length:415
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437     
           RPN5_YEAST    28 AQNDCNSALDQLLVLEKKTRQASDLASSKEVLAKIVDLLASRNKWDDLNEQLTLLSKKHGQLKLSIQYMIQKVMEYLKSSKSLDLNTRISVIETIRVVTENKIFVEVERARVTKDLVEIKKEEGKIDEAADILCELQVETYGSMEMSEKIQFILEQMELSILKGDYSQATVLSRKILKKTFKNPKYESLKLEYYNLLVKISLHKREYLEVAQYLQEIYQTDAIKSDEAKWKPVLSHIVYFLVLSPYGNLQNDLIHKIQNDNNLKKLESQESLVKLFTTNELMRWPIVQKTYEPVLNEDDLAFGGEANKHHWEDLQKRVIEHNLRVISEYYSRITLLRLNELLDLTESQTETYISDLVNQGIIYAKVNRPAKIVNFEKPKNSSQLLNEWSHNVDELLEHIETIGHLITKEEIMHGL 442
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh......hhhhhhhhhhhhhhhhh...hhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhh.eeehhhhhhhhh.hhhhhhhhhhhhhhhh...........eee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cr4 P  28 AQNDCNSALDQLLVLEKKTRQASDLASSKEVLAKIVDLLASRNKWDDLNEQLTLLSKKHGQLKLSIQYMIQKVMEYLKSSKSLDLNTRISVIETIRVVTENKIFVEVERARVTKDLVEIKKEEGKIDEAADILCELQVETYGSMEMSEKIQFILEQMELSILKGDYSQATVLSRKILKKTFKNPKYESLKLEYYNLLVKISLHKREYLEVAQYLQEIYQTDAIKSDEAKWKPVLSHIVYFLVLSPYGNLQNDLIHKIQNDNNLKKLESQESLVKLFTTNELMRWPIVQKTYEPVLNEDDLAFGGEANKHHWEDLQKRVIEHNLRVISEYYSRITLLRLNELLDLTESQTETYISDLVNQGIIYAKVNRPAKIVNFEKPKNSSQLLNEWSHNVDELLEHIETIGHLITKEEIMHGL 442
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437     

Chain Q from PDB  Type:PROTEIN  Length:431
 aligned with RPN6_YEAST | Q12377 from UniProtKB/Swiss-Prot  Length:434

    Alignment length:431
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430 
           RPN6_YEAST     1 MSLPGSKLEEARRLVNEKQYNEAEQVYLSLLDKDSSQSSAAAGASVDDKRRNEQETSILELGQLYVTMGAKDKLREFIPHSTEYMMQFAKSKTVKVLKTLIEKFEQVPDSLDDQIFVCEKSIEFAKREKRVFLKHSLSIKLATLHYQKKQYKDSLALINDLLREFKKLDDKPSLVDVHLLESKVYHKLRNLAKSKASLTAARTAANSIYCPTQTVAELDLMSGILHCEDKDYKTAFSYFFESFESYHNLTTHNSYEKACQVLKYMLLSKIMLNLIDDVKNILNAKYTKETYQSRGIDAMKAVAEAYNNRSLLDFNTALKQYEKELMGDELTRSHFNALYDTLLESNLCKIIEPFECVEISHISKIIGLDTQQVEGKLSQMILDKIFYGVLDQGNGWLYVYETPNQDATYDSALELVGQLNKVVDQLFEKAS 431
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....ee.....eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh....eehhhhhhhhh.hhhhhhhhhhhhhhhh...eeee....eeee........hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cr4 Q   1 MSLPGSKLEEARRLVNEKQYNEAEQVYLSLLDKDSSQSSAAAGASVDDKRRNEQETSILELGQLYVTMGAKDKLREFIPHSTEYMMQFAKSKTVKVLKTLIEKFEQVPDSLDDQIFVCEKSIEFAKREKRVFLKHSLSIKLATLHYQKKQYKDSLALINDLLREFKKLDDKPSLVDVHLLESKVYHKLRNLAKSKASLTAARTAANSIYCPTQTVAELDLMSGILHCEDKDYKTAFSYFFESFESYHNLTTHNSYEKACQVLKYMLLSKIMLNLIDDVKNILNAKYTKETYQSRGIDAMKAVAEAYNNRSLLDFNTALKQYEKELMGDELTRSHFNALYDTLLESNLCKIIEPFECVEISHISKIIGLDTQQVEGKLSQMILDKIFYGVLDQGNGWLYVYETPNQDATYDSALELVGQLNKVVDQLFEKAS 431
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430 

Chain R from PDB  Type:PROTEIN  Length:400
 aligned with RPN7_YEAST | Q06103 from UniProtKB/Swiss-Prot  Length:429

    Alignment length:400
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422
           RPN7_YEAST    23 NYEVSEKAFLLTQSKVSIEQRKEAAEFVLAKIKEEEMAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCKKNESKIKELNEKIQKLEEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTIARLGFFYNDQLYVKEKLEAVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFTSIELTSYESIATYASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYGAAVR 422
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh..........................hhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh.hhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh......hhhhhhhhhh...hhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhheee.hhhhhhhhh..hhhhhhhhhhhhhhhh...eeee....eeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------TPR_REGION  PDB: R:131-164        ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                PROSITE (5) ------------------------------------------------------------------------------------------------------------TPR  PDB: R:131-164               ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (5)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cr4 R  23 NYEVSEKAFLLTQSKVSIEQRKEAAEFVLAKIKEEEMAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCKKNESKIKELNEKIQKLEEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTIARLGFFYNDQLYVKEKLEAVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFTSIELTSYESIATYASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYGAAVR 422
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422

Chain S from PDB  Type:PROTEIN  Length:353
 aligned with RPN3_YEAST | P40016 from UniProtKB/Swiss-Prot  Length:523

    Alignment length:353
                                   135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475   
           RPN3_YEAST   126 KTIEVTAEINCFMHLLVQLFLWDSKELEQLVEFNRKVVIPNLLCYYNLRSLNLINAKLWFYIYLSHETLARSSEEINSDNQNIILRSTMMKFLKIASLKHDNETKAMLINLILRDFLNNGEVDSASDFISKLEYPHTDVSSSLEARYFFYLSKINAIQLDYSTANEYIIAAIRKAPHNSKSLGFLQQSNKLHCCIQLLMGDIPELSFFHQSNMQKSLLPYYHLTKAVKLGDLKKFTSTITKYKQLLLKDDTYQLCVRLRSNVIKTGIRIISLTYKKISLRDICLKLNLDSEQTVEYMVSRAIRDGVIEAKINHEDGFIETTELLNIYDSEDPQQVFDERIKFANQLHDEYLVS 478
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh...hhhhhhhhhh......hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhh.....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.....eeehhhhhhhhhhhh..hhhhhhhhhhhhh...eeee....eeee........hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cr4 S 126 KTIEVTAEINCFMHLLVQLFLWDSKELEQLVEFNRKVVIPNLLCYYNLRSLNLINAKLWFYIYLSHETLARSSEEINSDNQNIILRSTMMKFLKIASLKHDNETKAMLINLILRDFLNNGEVDSASDFISKLEYPHTDVSSSLEARYFFYLSKINAIQLDYSTANEYIIAAIRKAPHNSKSLGFLQQSNKLHCCIQLLMGDIPELSFFHQSNMQKSLLPYYHLTKAVKLGDLKKFTSTITKYKQLLLKDDTYQLCVRLRSNVIKTGIRIISLTYKKISLRDICLKLNLDSEQTVEYMVSRAIRDGVIEAKINHEDGFIETTELLNIYDSEDPQQVFDERIKFANQLHDEYLVS 478
                                   135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475   

Chain T from PDB  Type:PROTEIN  Length:272
 aligned with RPN12_YEAST | P32496 from UniProtKB/Swiss-Prot  Length:274

    Alignment length:272
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270  
          RPN12_YEAST     1 MPSLAELTKSLSIAFENGDYAACEKLLPPIKIELIKNNLLIPDLSIQNDIYLNDLMITKRILEVGALASIQTFNFDSFENYFNQLKPYYFSNNHKLSESDKKSKLISLYLLNLLSQNNTTKFHSELQYLDKHIKNLEDDSLLSYPIKLDRWLMEGSYQKAWDLLQSGSQNISEFDSFTDILKSAIRDEIAKNTELSYDFLPLSNIKALLFFNNEKETEKFALERNWPIVNSKVYFNNQSKEKADYEDEMMHEEDQKTNIIEKAMDYAISIEN 272
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.eehhhhhhhhhh..hhhhhhhhhhhh...ee..eee...................hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cr4 T   1 MPSLAELTKSLSIAFENGDYAACEKLLPPIKIELIKNNLLIPDLSIQNDIYLNDLMITKRILEVGALASIQTFNFDSFENYFNQLKPYYFSNNHKLSESDKKSKLISLYLLNLLSQNNTTKFHSELQYLDKHIKNLEDDSLLSYPIKLDRWLMEGSYQKAWDLLQSGSQNISEFDSFTDILKSAIRDEIAKNTELSYDFLPLSNIKALLFFNNEKETEKFALERNWPIVNSKVYFNNQSKEKADYEDEMMHEEDQKTNIIEKAMDYAISIEN 272
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270  

Chain U from PDB  Type:PROTEIN  Length:255
 aligned with RPN8_YEAST | Q08723 from UniProtKB/Swiss-Prot  Length:338

    Alignment length:304
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304    
           RPN8_YEAST     5 HEKVTIAPLVLLSALDHYERTQTKENKRCVGVILGDANSSTIRVTNSFALPFEEDEKNSDVWFLDHNYIENMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELFKKYTQNNPLLLIVDVKQQGVGLPTDAYVAIEQVKDDGTSTEKTFLHLPCTIEAEEAEEIGVEHLLRDVRDQAAGGLSIRLTNQLKSLKGLQSKLKDVVEYLDKVINKELPINHTILGKLQDVFNLLPNLGTPDDDEIDVENHDRINISNNLQKALTVKTNDELMVIYISNLVRSIIAFDDLIENKIQNKKIQEQRVKD 308
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeehhhhhhhhhhhhhhh........eeeeeee....eeeeeeeee..eee.......eeehhhhhhhhhhhhhhhh...eeeeeee.......hhhhhhhhhh.......eeeee..........eeeee....--------.............hhhhhhhhhhhhh-----------hhhhhhhhhhhhhhhhhhhhhhhhhhhh-------hhhhhhhhhhhhh-----------------------...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cr4 U   5 HEKVTIAPLVLLSALDHYERTQTKENKRCVGVILGDANSSTIRVTNSFALPFEEDEKNSDVWFLDHNYIENMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELFKKYTQNNPLLLIVDVKQQGVGLPTDAYVAIEQ--------EKTFLHLPCTIEAEEAEEIGVEHLLR-----------IRLTNQLKSLKGLQSKLKDVVEYLDKVI-------HTILGKLQDVFNL-----------------------NNLQKALTVKTNDELMVIYISNLVRSIIAFDDLIENKIQNKKIQEQRVKD 308
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       | -      |154       164       174 |       -   |   194       204       214|      224       234|        -         -    |  264       274       284       294       304    
                                                                                                                                                                   142      151                      176         188                        215     223         235                     259                                                 

Chain V from PDB  Type:PROTEIN  Length:247
 aligned with RPN11_YEAST | P43588 from UniProtKB/Swiss-Prot  Length:306

    Alignment length:276
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292      
          RPN11_YEAST    23 TKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLIDTGALINNLEPRQTTSNTGLLNKANIQALIHGLNRHYYSLNIDYHKTAKETKMLMNLHKEQWQSGLKMYDYEEKEESNLAATKSMVKIAEQYSKRIEEEKELTEEELKTRYVGRQDPKKHLSETADETLENNIVSVLTA 298
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeehhhhhhhhhhhhhhhh....eeeeeeee....eeeeeeeee........hhhhhhhhhhhhhhhhhhh.....eeeeeeee........hhhhhhhhhhhhhhh...eeeeee.........eeeee............-----------..hhhhhhhhhh........eeee..hhhhhhhhhhhh------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh------hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Q------------------------------T----------------------S------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4cr4 V  23 TKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLIDTGALINNL-----------LNKANIQALIHGLNRHYYSLNIDYHKTAKETKMLMNLH------------YEEKEESNLAATKSMVKIAEQYSKRIEEEKELTEEELKTR------PKKHLSETADETLENNIVSVLTA 298
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162     |   -       182       192       202       212    |    -       232       242       252       262      |  -   |   282       292      
                                                                                                                                                                           168         180                                  217          230                                    269    276                      

Chain W from PDB  Type:PROTEIN  Length:197
 aligned with RPN10_YEAST | P38886 from UniProtKB/Swiss-Prot  Length:268

    Alignment length:197
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       
          RPN10_YEAST     1 MVLEATVLVIDNSEYSRNGDFPRTRFEAQIDSVEFIFQAKRNSNPENTVGLISGAGANPRVLSTFTAEFGKILAGLHDTQIEGKLHMATALQIAQLTLKHRQNKVQHQRIVAFVCSPISDSRDELIRLAKTLKKNNVAVDIINFGEIEQNTELLDEFIAAVNNPQEETSHLLTVTPGPRLLYENIASSPIILEEGSS 197
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee..hhhhh......hhhhhhhhhhhhhhhhhhhhh...eeeeee.......eeeeee.hhhhhhhhhh........hhhhhhhhhhhhhhh......eeeeeee.......hhhhhhhhhhhhhhhh.eeeeeee.......hhhhhhhhhhh........eeee.....hhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----VWFA  PDB: W:5-190 UniProt: 5-190                                                                                                                                                         ------- PROSITE (4)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cr4 W   1 MVLEATVLVIDNSEYSRNGDFPRTRFEAQIDSVEFIFQAKRNSNPENTVGLISGAGANPRVLSTFTAEFGKILAGLHDTQIEGKLHMATALQIAQLTLKHRQNKVQHQRIVAFVCSPISDSRDELIRLAKTLKKNNVAVDIINFGEIEQNTELLDEFIAAVNNPQEETSHLLTVTPGPRLLYENIASSPIILEEGSS 197
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       

Chain X from PDB  Type:PROTEIN  Length:127
 aligned with RPN13_YEAST | O13563 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:127
                                    16        26        36        46        56        66        76        86        96       106       116       126       
          RPN13_YEAST     7 VIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWLQEKNSGNLPLNELSAKDKEIYNKMIGVLNNSS 133
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee....................eeee............eeee......................eee...........eee...........................hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cr4 X   7 VIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWLQEKNSGNLPLNELSAKDKEIYNKMIGVLNNSS 133
                                    16        26        36        46        56        66        76        86        96       106       116       126       

Chain Y from PDB  Type:PROTEIN  Length:19
 aligned with SEM1_YEAST | O94742 from UniProtKB/Swiss-Prot  Length:89

    Alignment length:19
                                    80         
           SEM1_YEAST    71 DDFTNELKAELDRYKRENQ  89
               SCOP domains ------------------- SCOP domains
               CATH domains ------------------- CATH domains
               Pfam domains ------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------- SAPs(SNPs)
                    PROSITE ------------------- PROSITE
                 Transcript ------------------- Transcript
                 4cr4 Y  71 DDFTNELKAELDRYKRENQ  89
                                    80         

Chain Z from PDB  Type:PROTEIN  Length:813
 aligned with RPN1_YEAST | P38764 from UniProtKB/Swiss-Prot  Length:993

    Alignment length:945
                                    58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668       678       688       698       708       718       728       738       748       758       768       778       788       798       808       818       828       838       848       858       868       878       888       898       908       918       928       938       948       958       968       978       988     
           RPN1_YEAST    49 LELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPLKFLRPTYPDLCSIYDKWTDPNLKSSLADVLSILAMTYSENGKHDSLRYRLLSDVSDFEGWGHEYIRHLALEIGEVYNDQVEKDAEDETSSDGSKSDGSAATSGFEFSKEDTLRLCLDIVPYFLKHNGEEDAVDLLLEIESIDKLPQFVDENTFQRVCQYMVACVPLLPPPEDVAFLKTAYSIYLSQNELTDAIALAVRLGEEDMIRSVFDATSDPVMHKQLAYILAAQKTSFEYEGVQDIIGNGKLSEHFLYLAKELNLTGPKVPEDIYKSHLDNSKSVFSSAGLDSAQQNLASSFVNGFLNLGYCNDKLIVDNDNWVYKTKGDGMTSAVASIGSIYQWNLDGLQQLDKYLYVDEPEVKAGALLGIGISASGVHDGEVEPALLLLQDYVTNPDTKISSAAILGLGIAFAGSKNDEVLGLLLPIAASTDLPIETAAMASLALAHVFVGTCNGDITTSIMDNFLERTAIELKTDWVRFLALALGILYMGQGEQVDDVLETISAIEHPMTSAIEVLVGSCAYTGTGDVLLIQDLLHRLTPKNVKGEEDADEEETAEGQTNSISDFLGEQVNEPTKNEEAEIEVDEMEVDAEGEEVEVKAEITEKKNGESLEGEEIKSEEKKGKSSDKDATTDGKNDDEEEEKEAGIVDELAYAVLGIALIALGEDIGKEMSLRHFGHLMHYGNEHIRRMVPLAMGIVSVSDPQMKVFDTLTRFSHDADLEVSMNSIFAMGLCGAGTNNARLAQLLRQLASYYSREQDALFITRLAQGLLHLGKGTMTMDVFNDAHVLNKVTLASILTTAVGLVSPSFMLKHHQLFYMLNAGIRPKFILALNDEGEPIKVNVRVGQAVETVGQAGRPKKITGWITQSTPVLLNHGERAELETDEYISYTSHIEGVVILKKNPDYREEE 993
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh...hhhhhhhhhhhhhhhh...........hhhhhhh.hhhhhhhhhh.......hhhhhhhhhhhhhhhh....hhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhh.....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhh....hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh.hhhhhhh..................hhhhhhhhh.hhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh....hhhhhhhhhh..hhhhhhhhhhhhhhhhh........hhhhhhhhhhh..hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh........hhhhhhhhhh....hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh--------------------------------------------------------------------------------------------------------------hhhhhhhhhhhh.....hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh....hhhhhhhhhhhh...hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh.ee...ee...eehhhhhhhhhhhhhh.........hhhhhhhhhhhhee...eee...............----------------------.................ee.......eeeee.hhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cr4 Z  49 LELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPLKFLRPTYPDLCSIYDKWTDPNLKSSLADVLSILAMTYSENGKHDSLRYRLLSDVSDFEGWGHEYIRHLALEIGEVYNDQVEKDAEDETSSDGSKSDGSAATSGFEFSKEDTLRLCLDIVPYFLKHNGEEDAVDLLLEIESIDKLPQFVDENTFQRVCQYMVACVPLLPPPEDVAFLKTAYSIYLSQNELTDAIALAVRLGEEDMIRSVFDATSDPVMHKQLAYILAAQKTSFEYEGVQDIIGNGKLSEHFLYLAKELNLTGPKVPEDIYKSHLDNSKSVFSSAGLDSAQQNLASSFVNGFLNLGYCNDKLIVDNDNWVYKTKGDGMTSAVASIGSIYQWNLDGLQQLDKYLYVDEPEVKAGALLGIGISASGVHDGEVEPALLLLQDYVTNPDTKISSAAILGLGIAFAGSKNDEVLGLLLPIAASTDLPIETAAMASLALAHVFVGTCNGDITTSIMDNFLERTAIELKTDWVRFLALALGILYMGQGEQVDDVLETISAIEHPMTSAIEVLVGSCAYTGTGDVLLIQDLLHRLT--------------------------------------------------------------------------------------------------------------LAYAVLGIALIALGEDIGKEMSLRHFGHLMHYGNEHIRRMVPLAMGIVSVSDPQMKVFDTLTRFSHDADLEVSMNSIFAMGLCGAGTNNARLAQLLRQLASYYSREQDALFITRLAQGLLHLGKGTMTMDVFNDAHVLNKVTLASILTTAVGLVSPSFMLKHHQLFYMLNAGIRPKFILALNDEGEPIKVNVRVGQ----------------------PVLLNHGERAELETDEYISYTSHIEGVVILKKNPDYREEE 993
                                    58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618      |  -         -         -         -         -         -         -         -         -         -         -       738       748       758       768       778       788       798       808       818       828       838       848       858       868       878       888       898       908       918       928  |      -         -     | 958       968       978       988     
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          625                                                                                                            736                                                                                                                                                                                                931                    954                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4CR4)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4CR4)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4CR4)

(-) Gene Ontology  (78, 511)

Asymmetric/Biological Unit(hide GO term definitions)
Chain 1   (PSB1_YEAST | P38624)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019774    proteasome core complex, beta-subunit complex    The proteasome core subcomplex that constitutes the two inner rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain 2   (PSB2_YEAST | P25043)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019774    proteasome core complex, beta-subunit complex    The proteasome core subcomplex that constitutes the two inner rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain 3   (PSB3_YEAST | P25451)
molecular function
    GO:0061133    endopeptidase activator activity    Increases the activity of an endopeptidase, any enzyme that hydrolyzes nonterminal peptide bonds in polypeptides.
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010950    positive regulation of endopeptidase activity    Any process that increases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019774    proteasome core complex, beta-subunit complex    The proteasome core subcomplex that constitutes the two inner rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain 4   (PSB4_YEAST | P22141)
molecular function
    GO:0061133    endopeptidase activator activity    Increases the activity of an endopeptidase, any enzyme that hydrolyzes nonterminal peptide bonds in polypeptides.
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010950    positive regulation of endopeptidase activity    Any process that increases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019774    proteasome core complex, beta-subunit complex    The proteasome core subcomplex that constitutes the two inner rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain 5   (PSB5_YEAST | P30656)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0080129    proteasome core complex assembly    The aggregation, arrangement and bonding together of a mature, active 20S proteasome core particle complex that does not contain any regulatory particles.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019774    proteasome core complex, beta-subunit complex    The proteasome core subcomplex that constitutes the two inner rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain 6   (PSB6_YEAST | P23724)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019774    proteasome core complex, beta-subunit complex    The proteasome core subcomplex that constitutes the two inner rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain 7   (PSB7_YEAST | P30657)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043248    proteasome assembly    The aggregation, arrangement and bonding together of a mature, active proteasome complex.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019774    proteasome core complex, beta-subunit complex    The proteasome core subcomplex that constitutes the two inner rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain A   (PSA1_YEAST | P21243)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0042175    nuclear outer membrane-endoplasmic reticulum membrane network    The continuous network of membranes encompassing the nuclear outer membrane and the endoplasmic reticulum membrane.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019773    proteasome core complex, alpha-subunit complex    The proteasome core subcomplex that constitutes the two outer rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain B   (PSA2_YEAST | P23639)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0042175    nuclear outer membrane-endoplasmic reticulum membrane network    The continuous network of membranes encompassing the nuclear outer membrane and the endoplasmic reticulum membrane.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019773    proteasome core complex, alpha-subunit complex    The proteasome core subcomplex that constitutes the two outer rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain C   (PSA3_YEAST | P23638)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0080129    proteasome core complex assembly    The aggregation, arrangement and bonding together of a mature, active 20S proteasome core particle complex that does not contain any regulatory particles.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0042175    nuclear outer membrane-endoplasmic reticulum membrane network    The continuous network of membranes encompassing the nuclear outer membrane and the endoplasmic reticulum membrane.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019773    proteasome core complex, alpha-subunit complex    The proteasome core subcomplex that constitutes the two outer rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain D   (PSA4_YEAST | P40303)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0042175    nuclear outer membrane-endoplasmic reticulum membrane network    The continuous network of membranes encompassing the nuclear outer membrane and the endoplasmic reticulum membrane.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019773    proteasome core complex, alpha-subunit complex    The proteasome core subcomplex that constitutes the two outer rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain E   (PSA5_YEAST | P32379)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0042175    nuclear outer membrane-endoplasmic reticulum membrane network    The continuous network of membranes encompassing the nuclear outer membrane and the endoplasmic reticulum membrane.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019773    proteasome core complex, alpha-subunit complex    The proteasome core subcomplex that constitutes the two outer rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain F   (PSA6_YEAST | P40302)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0042175    nuclear outer membrane-endoplasmic reticulum membrane network    The continuous network of membranes encompassing the nuclear outer membrane and the endoplasmic reticulum membrane.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019773    proteasome core complex, alpha-subunit complex    The proteasome core subcomplex that constitutes the two outer rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain G   (PSA7_YEAST | P21242)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003729    mRNA binding    Interacting selectively and non-covalently with messenger RNA (mRNA), an intermediate molecule between DNA and protein. mRNA includes UTR and coding sequences, but does not contain introns.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0042175    nuclear outer membrane-endoplasmic reticulum membrane network    The continuous network of membranes encompassing the nuclear outer membrane and the endoplasmic reticulum membrane.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019773    proteasome core complex, alpha-subunit complex    The proteasome core subcomplex that constitutes the two outer rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain H   (PRS7_YEAST | P33299)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016887    ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
    GO:0017025    TBP-class protein binding    Interacting selectively and non-covalently with a member of the class of TATA-binding proteins (TBP), including any of the TBP-related factors (TRFs).
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0036402    proteasome-activating ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate, which promotes unfolding of protein substrates, and channel opening of the core proteasome.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0045899    positive regulation of RNA polymerase II transcriptional preinitiation complex assembly    Any process that activates or increases the frequency, rate or extent of RNA polymerase II transcriptional preinitiation complex assembly.
    GO:1901800    positive regulation of proteasomal protein catabolic process    Any process that activates or increases the frequency, rate or extent of proteasomal protein catabolic process.
    GO:0045732    positive regulation of protein catabolic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0070682    proteasome regulatory particle assembly    The aggregation, arrangement and bonding together of a mature, active proteasome regulatory particle complex.
    GO:0030163    protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0030433    ubiquitin-dependent ERAD pathway    The series of steps necessary to target endoplasmic reticulum (ER)-resident proteins for degradation by the cytoplasmic proteasome. Begins with recognition of the ER-resident protein, includes retrotranslocation (dislocation) of the protein from the ER to the cytosol, protein ubiquitination necessary for correct substrate transfer, transport of the protein to the proteasome, and ends with degradation of the protein by the cytoplasmic proteasome.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0031597    cytosolic proteasome complex    A proteasome complex found in the cytosol of a cell.
    GO:0031595    nuclear proteasome complex    A proteasome found in the nucleus of a cell.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008540    proteasome regulatory particle, base subcomplex    The subcomplex of the proteasome regulatory particle that directly associates with the proteasome core complex.

Chain I   (PRS4_YEAST | P40327)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016887    ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
    GO:0017025    TBP-class protein binding    Interacting selectively and non-covalently with a member of the class of TATA-binding proteins (TBP), including any of the TBP-related factors (TRFs).
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0036402    proteasome-activating ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate, which promotes unfolding of protein substrates, and channel opening of the core proteasome.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0070651    nonfunctional rRNA decay    An rRNA catabolic process that results in the targeted detection and degradation of aberrant rRNAs contained within translationally defective ribosomes, thereby acting as a quality-control system.
    GO:0043171    peptide catabolic process    The chemical reactions and pathways resulting in the breakdown of peptides, compounds of 2 or more (but usually less than 100) amino acids where the alpha carboxyl group of one is bound to the alpha amino group of another.
    GO:0045899    positive regulation of RNA polymerase II transcriptional preinitiation complex assembly    Any process that activates or increases the frequency, rate or extent of RNA polymerase II transcriptional preinitiation complex assembly.
    GO:1901800    positive regulation of proteasomal protein catabolic process    Any process that activates or increases the frequency, rate or extent of proteasomal protein catabolic process.
    GO:0045732    positive regulation of protein catabolic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0070682    proteasome regulatory particle assembly    The aggregation, arrangement and bonding together of a mature, active proteasome regulatory particle complex.
    GO:0030163    protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0031503    protein complex localization    A localization process that acts on a protein complex; the complex is transported to, or maintained in, a specific location.
    GO:0030433    ubiquitin-dependent ERAD pathway    The series of steps necessary to target endoplasmic reticulum (ER)-resident proteins for degradation by the cytoplasmic proteasome. Begins with recognition of the ER-resident protein, includes retrotranslocation (dislocation) of the protein from the ER to the cytosol, protein ubiquitination necessary for correct substrate transfer, transport of the protein to the proteasome, and ends with degradation of the protein by the cytoplasmic proteasome.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0031597    cytosolic proteasome complex    A proteasome complex found in the cytosol of a cell.
    GO:0031595    nuclear proteasome complex    A proteasome found in the nucleus of a cell.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008540    proteasome regulatory particle, base subcomplex    The subcomplex of the proteasome regulatory particle that directly associates with the proteasome core complex.

Chain J   (PRS8_YEAST | Q01939)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016887    ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
    GO:0017025    TBP-class protein binding    Interacting selectively and non-covalently with a member of the class of TATA-binding proteins (TBP), including any of the TBP-related factors (TRFs).
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0036402    proteasome-activating ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate, which promotes unfolding of protein substrates, and channel opening of the core proteasome.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019904    protein domain specific binding    Interacting selectively and non-covalently with a specific domain of a protein.
biological process
    GO:0006338    chromatin remodeling    Dynamic structural changes to eukaryotic chromatin occurring throughout the cell division cycle. These changes range from the local changes necessary for transcriptional regulation to global changes necessary for chromosome segregation.
    GO:0043433    negative regulation of sequence-specific DNA binding transcription factor activity    Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
    GO:0070651    nonfunctional rRNA decay    An rRNA catabolic process that results in the targeted detection and degradation of aberrant rRNAs contained within translationally defective ribosomes, thereby acting as a quality-control system.
    GO:0006289    nucleotide-excision repair    A DNA repair process in which a small region of the strand surrounding the damage is removed from the DNA helix as an oligonucleotide. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase. Nucleotide excision repair recognizes a wide range of substrates, including damage caused by UV irradiation (pyrimidine dimers and 6-4 photoproducts) and chemicals (intrastrand cross-links and bulky adducts).
    GO:0045899    positive regulation of RNA polymerase II transcriptional preinitiation complex assembly    Any process that activates or increases the frequency, rate or extent of RNA polymerase II transcriptional preinitiation complex assembly.
    GO:1901800    positive regulation of proteasomal protein catabolic process    Any process that activates or increases the frequency, rate or extent of proteasomal protein catabolic process.
    GO:0051091    positive regulation of sequence-specific DNA binding transcription factor activity    Any process that activates or increases the frequency, rate or extent of activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
    GO:0032968    positive regulation of transcription elongation from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription elongation, the extension of an RNA molecule after transcription initiation and promoter clearance by the addition of ribonucleotides, catalyzed by RNA polymerase II.
    GO:0070682    proteasome regulatory particle assembly    The aggregation, arrangement and bonding together of a mature, active proteasome regulatory particle complex.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0030163    protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0030433    ubiquitin-dependent ERAD pathway    The series of steps necessary to target endoplasmic reticulum (ER)-resident proteins for degradation by the cytoplasmic proteasome. Begins with recognition of the ER-resident protein, includes retrotranslocation (dislocation) of the protein from the ER to the cytosol, protein ubiquitination necessary for correct substrate transfer, transport of the protein to the proteasome, and ends with degradation of the protein by the cytoplasmic proteasome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0031595    nuclear proteasome complex    A proteasome found in the nucleus of a cell.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008540    proteasome regulatory particle, base subcomplex    The subcomplex of the proteasome regulatory particle that directly associates with the proteasome core complex.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain K   (PRS6B_YEAST | P33298)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016887    ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
    GO:0017025    TBP-class protein binding    Interacting selectively and non-covalently with a member of the class of TATA-binding proteins (TBP), including any of the TBP-related factors (TRFs).
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0036402    proteasome-activating ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate, which promotes unfolding of protein substrates, and channel opening of the core proteasome.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0045899    positive regulation of RNA polymerase II transcriptional preinitiation complex assembly    Any process that activates or increases the frequency, rate or extent of RNA polymerase II transcriptional preinitiation complex assembly.
    GO:1901800    positive regulation of proteasomal protein catabolic process    Any process that activates or increases the frequency, rate or extent of proteasomal protein catabolic process.
    GO:0070682    proteasome regulatory particle assembly    The aggregation, arrangement and bonding together of a mature, active proteasome regulatory particle complex.
    GO:0030163    protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0030433    ubiquitin-dependent ERAD pathway    The series of steps necessary to target endoplasmic reticulum (ER)-resident proteins for degradation by the cytoplasmic proteasome. Begins with recognition of the ER-resident protein, includes retrotranslocation (dislocation) of the protein from the ER to the cytosol, protein ubiquitination necessary for correct substrate transfer, transport of the protein to the proteasome, and ends with degradation of the protein by the cytoplasmic proteasome.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0031597    cytosolic proteasome complex    A proteasome complex found in the cytosol of a cell.
    GO:0031595    nuclear proteasome complex    A proteasome found in the nucleus of a cell.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008540    proteasome regulatory particle, base subcomplex    The subcomplex of the proteasome regulatory particle that directly associates with the proteasome core complex.

Chain L   (PRS10_YEAST | P53549)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016887    ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
    GO:0017025    TBP-class protein binding    Interacting selectively and non-covalently with a member of the class of TATA-binding proteins (TBP), including any of the TBP-related factors (TRFs).
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0036402    proteasome-activating ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate, which promotes unfolding of protein substrates, and channel opening of the core proteasome.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019904    protein domain specific binding    Interacting selectively and non-covalently with a specific domain of a protein.
biological process
    GO:0006289    nucleotide-excision repair    A DNA repair process in which a small region of the strand surrounding the damage is removed from the DNA helix as an oligonucleotide. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase. Nucleotide excision repair recognizes a wide range of substrates, including damage caused by UV irradiation (pyrimidine dimers and 6-4 photoproducts) and chemicals (intrastrand cross-links and bulky adducts).
    GO:0045899    positive regulation of RNA polymerase II transcriptional preinitiation complex assembly    Any process that activates or increases the frequency, rate or extent of RNA polymerase II transcriptional preinitiation complex assembly.
    GO:1901800    positive regulation of proteasomal protein catabolic process    Any process that activates or increases the frequency, rate or extent of proteasomal protein catabolic process.
    GO:0032968    positive regulation of transcription elongation from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription elongation, the extension of an RNA molecule after transcription initiation and promoter clearance by the addition of ribonucleotides, catalyzed by RNA polymerase II.
    GO:0070682    proteasome regulatory particle assembly    The aggregation, arrangement and bonding together of a mature, active proteasome regulatory particle complex.
    GO:0030163    protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0030433    ubiquitin-dependent ERAD pathway    The series of steps necessary to target endoplasmic reticulum (ER)-resident proteins for degradation by the cytoplasmic proteasome. Begins with recognition of the ER-resident protein, includes retrotranslocation (dislocation) of the protein from the ER to the cytosol, protein ubiquitination necessary for correct substrate transfer, transport of the protein to the proteasome, and ends with degradation of the protein by the cytoplasmic proteasome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0031597    cytosolic proteasome complex    A proteasome complex found in the cytosol of a cell.
    GO:0031595    nuclear proteasome complex    A proteasome found in the nucleus of a cell.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008540    proteasome regulatory particle, base subcomplex    The subcomplex of the proteasome regulatory particle that directly associates with the proteasome core complex.

Chain M   (PRS6A_YEAST | P33297)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016887    ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
    GO:0017025    TBP-class protein binding    Interacting selectively and non-covalently with a member of the class of TATA-binding proteins (TBP), including any of the TBP-related factors (TRFs).
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0036402    proteasome-activating ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate, which promotes unfolding of protein substrates, and channel opening of the core proteasome.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0045899    positive regulation of RNA polymerase II transcriptional preinitiation complex assembly    Any process that activates or increases the frequency, rate or extent of RNA polymerase II transcriptional preinitiation complex assembly.
    GO:1901800    positive regulation of proteasomal protein catabolic process    Any process that activates or increases the frequency, rate or extent of proteasomal protein catabolic process.
    GO:0070682    proteasome regulatory particle assembly    The aggregation, arrangement and bonding together of a mature, active proteasome regulatory particle complex.
    GO:0030163    protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0030433    ubiquitin-dependent ERAD pathway    The series of steps necessary to target endoplasmic reticulum (ER)-resident proteins for degradation by the cytoplasmic proteasome. Begins with recognition of the ER-resident protein, includes retrotranslocation (dislocation) of the protein from the ER to the cytosol, protein ubiquitination necessary for correct substrate transfer, transport of the protein to the proteasome, and ends with degradation of the protein by the cytoplasmic proteasome.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0031597    cytosolic proteasome complex    A proteasome complex found in the cytosol of a cell.
    GO:0031595    nuclear proteasome complex    A proteasome found in the nucleus of a cell.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008540    proteasome regulatory particle, base subcomplex    The subcomplex of the proteasome regulatory particle that directly associates with the proteasome core complex.

Chain N   (RPN2_YEAST | P32565)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0030234    enzyme regulator activity    Binds to and modulates the activity of an enzyme.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0030674    protein binding, bridging    The binding activity of a molecule that brings together two or more protein molecules, or a protein and another macromolecule or complex, through a selective, non-covalent, often stoichiometric interaction, permitting those molecules to function in a coordinated way.
biological process
    GO:0043248    proteasome assembly    The aggregation, arrangement and bonding together of a mature, active proteasome complex.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0050790    regulation of catalytic activity    Any process that modulates the activity of an enzyme.
    GO:0042176    regulation of protein catabolic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008540    proteasome regulatory particle, base subcomplex    The subcomplex of the proteasome regulatory particle that directly associates with the proteasome core complex.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain O   (RPN9_YEAST | Q04062)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
    GO:0043248    proteasome assembly    The aggregation, arrangement and bonding together of a mature, active proteasome complex.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008541    proteasome regulatory particle, lid subcomplex    The subcomplex of the proteasome regulatory particle that forms the peripheral lid, which is added on top of the base subcomplex.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain P   (RPN5_YEAST | Q12250)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0008180    COP9 signalosome    A protein complex that catalyzes the deneddylation of proteins, including the cullin component of SCF ubiquitin E3 ligase; deneddylation increases the activity of cullin family ubiquitin ligases. The signalosome is involved in many regulatory process, including some which control development, in many species; also regulates photomorphogenesis in plants; in many species its subunits are highly similar to those of the proteasome.
    GO:0031595    nuclear proteasome complex    A proteasome found in the nucleus of a cell.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008541    proteasome regulatory particle, lid subcomplex    The subcomplex of the proteasome regulatory particle that forms the peripheral lid, which is added on top of the base subcomplex.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain Q   (RPN6_YEAST | Q12377)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
    GO:0043248    proteasome assembly    The aggregation, arrangement and bonding together of a mature, active proteasome complex.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008541    proteasome regulatory particle, lid subcomplex    The subcomplex of the proteasome regulatory particle that forms the peripheral lid, which is added on top of the base subcomplex.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain R   (RPN7_YEAST | Q06103)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008541    proteasome regulatory particle, lid subcomplex    The subcomplex of the proteasome regulatory particle that forms the peripheral lid, which is added on top of the base subcomplex.

Chain S   (RPN3_YEAST | P40016)
molecular function
    GO:0030234    enzyme regulator activity    Binds to and modulates the activity of an enzyme.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0050790    regulation of catalytic activity    Any process that modulates the activity of an enzyme.
    GO:0042176    regulation of protein catabolic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008541    proteasome regulatory particle, lid subcomplex    The subcomplex of the proteasome regulatory particle that forms the peripheral lid, which is added on top of the base subcomplex.

Chain T   (RPN12_YEAST | P32496)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0043248    proteasome assembly    The aggregation, arrangement and bonding together of a mature, active proteasome complex.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005838    proteasome regulatory particle    A multisubunit complex, which caps one or both ends of the proteasome core complex. This complex recognizes and unfolds ubiquitinated proteins, and translocates them to the proteasome core complex.
    GO:0008541    proteasome regulatory particle, lid subcomplex    The subcomplex of the proteasome regulatory particle that forms the peripheral lid, which is added on top of the base subcomplex.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain U   (RPN8_YEAST | Q08723)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008541    proteasome regulatory particle, lid subcomplex    The subcomplex of the proteasome regulatory particle that forms the peripheral lid, which is added on top of the base subcomplex.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain V   (RPN11_YEAST | P43588)
molecular function
    GO:0008234    cysteine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008237    metallopeptidase activity    Catalysis of the hydrolysis of peptide bonds by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004843    thiol-dependent ubiquitin-specific protease activity    Catalysis of the thiol-dependent hydrolysis of a peptide bond formed by the C-terminal glycine of ubiquitin and another protein.
    GO:0036459    thiol-dependent ubiquitinyl hydrolase activity    Catalysis of the thiol-dependent hydrolysis of an ester, thioester, amide, peptide or isopeptide bond formed by the C-terminal glycine of ubiquitin.
biological process
    GO:0000266    mitochondrial fission    The division of a mitochondrion within a cell to form two or more separate mitochondrial compartments.
    GO:0016559    peroxisome fission    The division of a mature peroxisome within a cell to form two or more separate peroxisome compartments.
    GO:1902906    proteasome storage granule assembly    The aggregation, arrangement and bonding together of a set of components to form a proteasome storage granule.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0016579    protein deubiquitination    The removal of one or more ubiquitin groups from a protein.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008541    proteasome regulatory particle, lid subcomplex    The subcomplex of the proteasome regulatory particle that forms the peripheral lid, which is added on top of the base subcomplex.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain W   (RPN10_YEAST | P38886)
molecular function
    GO:0031593    polyubiquitin modification-dependent protein binding    Interacting selectively and non-covalently with a protein upon poly-ubiquitination of the target protein.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
    GO:0043248    proteasome assembly    The aggregation, arrangement and bonding together of a mature, active proteasome complex.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008540    proteasome regulatory particle, base subcomplex    The subcomplex of the proteasome regulatory particle that directly associates with the proteasome core complex.

Chain X   (RPN13_YEAST | O13563)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043130    ubiquitin binding    Interacting selectively and non-covalently with ubiquitin, a protein that when covalently bound to other cellular proteins marks them for proteolytic degradation.
biological process
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008541    proteasome regulatory particle, lid subcomplex    The subcomplex of the proteasome regulatory particle that forms the peripheral lid, which is added on top of the base subcomplex.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain Y   (SEM1_YEAST | O94742)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0072742    SAGA complex localization to transcription regulatory region    Any process in which a SAGA complex is transported to, or maintained in, a specific location in the transcription regulatory region of a gene.
    GO:0000724    double-strand break repair via homologous recombination    The error-free repair of a double-strand break in DNA in which the broken DNA molecule is repaired using homologous sequences. A strand in the broken DNA searches for a homologous region in an intact chromosome to serve as the template for DNA synthesis. The restoration of two intact DNA molecules results in the exchange, reciprocal or nonreciprocal, of genetic material between the intact DNA molecule and the broken DNA molecule.
    GO:0006887    exocytosis    A process of secretion by a cell that results in the release of intracellular molecules (e.g. hormones, matrix proteins) contained within a membrane-bounded vesicle. Exocytosis can occur either by full fusion, when the vesicle collapses into the plasma membrane, or by a kiss-and-run mechanism that involves the formation of a transient contact, a pore, between a granule (for exemple of chromaffin cells) and the plasma membrane. The latter process most of the time leads to only partial secretion of the granule content. Exocytosis begins with steps that prepare vesicles for fusion with the membrane (tethering and docking) and ends when molecules are secreted from the cell.
    GO:0030447    filamentous growth    The process in which a multicellular organism, a unicellular organism or a group of unicellular organisms grow in a threadlike, filamentous shape.
    GO:0016578    histone deubiquitination    The modification of histones by removal of ubiquitin groups.
    GO:0006406    mRNA export from nucleus    The directed movement of mRNA from the nucleus to the cytoplasm.
    GO:0035753    maintenance of DNA trinucleotide repeats    Any process involved in sustaining the fidelity and copy number of DNA trinucleotide repeats. DNA trinucleotide repeats are naturally occurring runs of three base-pairs.
    GO:0043248    proteasome assembly    The aggregation, arrangement and bonding together of a mature, active proteasome complex.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0051726    regulation of cell cycle    Any process that modulates the rate or extent of progression through the cell cycle.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008541    proteasome regulatory particle, lid subcomplex    The subcomplex of the proteasome regulatory particle that forms the peripheral lid, which is added on top of the base subcomplex.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Chain Z   (RPN1_YEAST | P38764)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0030234    enzyme regulator activity    Binds to and modulates the activity of an enzyme.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0030674    protein binding, bridging    The binding activity of a molecule that brings together two or more protein molecules, or a protein and another macromolecule or complex, through a selective, non-covalent, often stoichiometric interaction, permitting those molecules to function in a coordinated way.
biological process
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0050790    regulation of catalytic activity    Any process that modulates the activity of an enzyme.
    GO:0042176    regulation of protein catabolic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008540    proteasome regulatory particle, base subcomplex    The subcomplex of the proteasome regulatory particle that directly associates with the proteasome core complex.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4cr4)
 
  Sites
(no "Sites" information available for 4cr4)
 
  Cis Peptide Bonds
    Ala I:275 - Pro I:276   [ RasMol ]  
    Ala J:241 - Pro J:242   [ RasMol ]  
    Ala K:265 - Pro K:266   [ RasMol ]  
    Ala M:274 - Pro M:275   [ RasMol ]  
    Asn I:102 - Pro I:103   [ RasMol ]  
    Gly U:96 - Pro U:97   [ RasMol ]  
    Leu M:75 - Pro M:76   [ RasMol ]  
    Pro W:22 - Arg W:23   [ RasMol ]  
    Val K:92 - Pro K:93   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4cr4
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PRS10_YEAST | P53549
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PRS4_YEAST | P40327
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PRS6A_YEAST | P33297
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PRS6B_YEAST | P33298
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PRS7_YEAST | P33299
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PRS8_YEAST | Q01939
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA1_YEAST | P21243
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA2_YEAST | P23639
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA3_YEAST | P23638
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA4_YEAST | P40303
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA5_YEAST | P32379
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA6_YEAST | P40302
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA7_YEAST | P21242
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB1_YEAST | P38624
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB2_YEAST | P25043
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB3_YEAST | P25451
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB4_YEAST | P22141
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB5_YEAST | P30656
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB6_YEAST | P23724
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PSB7_YEAST | P30657
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RPN10_YEAST | P38886
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RPN11_YEAST | P43588
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RPN12_YEAST | P32496
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RPN13_YEAST | O13563
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RPN1_YEAST | P38764
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RPN2_YEAST | P32565
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RPN3_YEAST | P40016
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RPN5_YEAST | Q12250
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RPN6_YEAST | Q12377
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RPN7_YEAST | Q06103
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RPN8_YEAST | Q08723
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RPN9_YEAST | Q04062
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SEM1_YEAST | O94742
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.25.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PRS10_YEAST | P53549
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PRS4_YEAST | P40327
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PRS6A_YEAST | P33297
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PRS6B_YEAST | P33298
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PRS7_YEAST | P33299
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PRS8_YEAST | Q01939
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA1_YEAST | P21243
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA2_YEAST | P23639
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA3_YEAST | P23638
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA4_YEAST | P40303
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA5_YEAST | P32379
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA6_YEAST | P40302
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA7_YEAST | P21242
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB1_YEAST | P38624
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB2_YEAST | P25043
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB3_YEAST | P25451
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB4_YEAST | P22141
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB5_YEAST | P30656
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB6_YEAST | P23724
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSB7_YEAST | P30657
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RPN10_YEAST | P38886
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RPN11_YEAST | P43588
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RPN12_YEAST | P32496
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RPN13_YEAST | O13563
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RPN1_YEAST | P38764
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RPN2_YEAST | P32565
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RPN3_YEAST | P40016
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RPN5_YEAST | Q12250
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RPN6_YEAST | Q12377
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RPN7_YEAST | Q06103
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RPN8_YEAST | Q08723
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RPN9_YEAST | Q04062
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SEM1_YEAST | O94742
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PRS10_YEAST | P535493jco 3jcp 4cr2 4cr3 5a5b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PRS4_YEAST | P403273jco 3jcp 4cr2 4cr3 5a5b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PRS6A_YEAST | P332973jco 3jcp 3whk 3whl 4cr2 4cr3 5a5b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PRS6B_YEAST | P332982dzn 2dzo 3jco 3jcp 4cr2 4cr3 5a5b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PRS7_YEAST | P332993jco 3jcp 3vlf 4a3v 4cr2 4cr3 4jpo 5a5b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PRS8_YEAST | Q019393jco 3jcp 4cr2 4cr3 5a5b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSA1_YEAST | P212431fnt 1g0u 1g65 1jd2 1ryp 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSA2_YEAST | P236391fnt 1g0u 1g65 1jd2 1ryp 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSA3_YEAST | P236381fnt 1g0u 1g65 1jd2 1ryp 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSA4_YEAST | P403031fnt 1g0u 1g65 1jd2 1ryp 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSA5_YEAST | P323791fnt 1g0u 1g65 1jd2 1ryp 1z7q 2f16 2fak 2gpl 2z5c 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSA6_YEAST | P403021fnt 1g0u 1g65 1jd2 1ryp 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSA7_YEAST | P212421fnt 1g0u 1g65 1jd2 1ryp 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSB1_YEAST | P386241fnt 1g0u 1g65 1jd2 1ryp 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSB2_YEAST | P250431fnt 1g0u 1g65 1jd2 1ryp 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSB3_YEAST | P254511fnt 1g0u 1g65 1jd2 1ryp 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSB4_YEAST | P221411fnt 1g0u 1g65 1jd2 1ryp 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSB5_YEAST | P306561fnt 1g0u 1g65 1jd2 1ryp 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSB6_YEAST | P237241fnt 1g0u 1g65 1jd2 1ryp 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        PSB7_YEAST | P306571fnt 1g0u 1g65 1jd2 1ryp 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk
        RPN10_YEAST | P388863jco 3jcp 4cr2 4cr3 5a5b 5ln1 5mpb 5mpc 5mpd 5mpe 5wvi 5wvk
        RPN11_YEAST | P435883j47 3jck 3jco 3jcp 4cr2 4cr3 4o8x 4o8y 4ocl 4ocm 4ocn 4owp 5a5b 5mpb 5mpc 5mpd 5mpe 5wvi 5wvk
        RPN12_YEAST | P324963j47 3jck 3jco 3jcp 4cr2 4cr3 5a5b 5mpb 5mpc 5mpd 5mpe 5wvi 5wvk
        RPN13_YEAST | O135632z4d 3jco 3jcp 4cr2 4cr3 5a5b 5mpb 5mpc 5mpd 5mpe 5wvi 5wvk
        RPN1_YEAST | P387642n3t 2n3u 2n3v 2n3w 2nbw 3jco 3jcp 4cr2 4cr3 5a5b 5mpb 5mpc 5mpd 5mpe 5wvi 5wvk
        RPN2_YEAST | P325653jco 3jcp 4ady 4cr2 4cr3 5a5b 5mpb 5mpc 5mpd 5mpe 5wvi 5wvk
        RPN3_YEAST | P400163j47 3jck 3jco 3jcp 4cr2 4cr3 5a5b 5mpb 5mpc 5mpd 5mpe 5wvi 5wvk
        RPN5_YEAST | Q122503j47 3jck 3jco 3jcp 4cr2 4cr3 5a5b 5mpb 5mpc 5mpd 5mpe 5wvi 5wvk
        RPN6_YEAST | Q123773j47 3jck 3jco 3jcp 4cr2 4cr3 5a5b 5mpb 5mpc 5mpd 5mpe 5wvi 5wvk
        RPN7_YEAST | Q061033j47 3jck 3jco 3jcp 4cr2 4cr3 5a5b 5mpb 5mpc 5mpd 5mpe 5wvi 5wvk
        RPN8_YEAST | Q087233j47 3jck 3jco 3jcp 4cr2 4cr3 4o8x 4o8y 4ocl 4ocm 4ocn 4owp 5a5b 5mpb 5mpc 5mpd 5mpe 5wvi 5wvk
        RPN9_YEAST | Q040622mqw 2mr3 2mri 3j47 3jck 3jco 3jcp 4cr2 4cr3 5a5b 5mpb 5mpc 5mpd 5mpe 5wvi 5wvk
        SEM1_YEAST | O947423jck 3jco 3jcp 3t5v 4cr2 4cr3 4trq 5a5b 5g5p 5l3t 5mpb 5mpc 5mpd 5mpe 5ubp 5wvi 5wvk

(-) Related Entries Specified in the PDB File

4cr2 DEEP CLASSIFICATION OF A LARGE CRYO-EM DATASET DEFINES THE CONFORMATIONAL LANDSCAPE OF THE 26S PROTEASOME
4cr3 DEEP CLASSIFICATION OF A LARGE CRYO-EM DATASET DEFINES THE CONFORMATIONAL LANDSCAPE OF THE 26S PROTEASOME