Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A NOVEL CHAPERONE COMPLEX FOR YEAST 20S PROTEASOME ASSEMBLY
 
Authors :  H. Yashiroda, T. Mizushima, K. Okamoto, T. Kameyama, H. Hayashi, T. Kishimoto, M. Kasahara, E. Kurimoto, E. Sakata, A. Suzuki, Y. Hirano, S. Murata, K. Kato, T. Yamane, K. Tanaka
Date :  03 Jul 07  (Deposition) - 22 Jan 08  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,B,C  (1x)
Biol. Unit 2:  D,E,F  (1x)
Keywords :  Proteasome, Chaperone, S. Cerevisiae, Chaperone/Hydrolase Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Yashiroda, T. Mizushima, K. Okamoto, T. Kameyama, H. Hayashi, T. Kishimoto, S. Niwa, M. Kasahara, E. Kurimoto, E. Sakata, K. Takagi, A. Suzuki, Y. Hirano, S. Murata, K. Kato, T. Yamane, K. Tanaka
Crystal Structure Of A Chaperone Complex That Contributes To The Assembly Of Yeast 20S Proteasomes
Nat. Struct. Mol. Biol. V. 15 228 2008
PubMed-ID: 18278057  |  Reference-DOI: 10.1038/NSMB.1386
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN YPL144W
    Chains: A, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET28
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
    Synonym: DMP1
 
Molecule 2 - UNCHARACTERIZED PROTEIN YLR021W
    Chains: B, E
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET28
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 1-60, 91-179
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
    Synonym: DMP2
 
Molecule 3 - PROTEASOME COMPONENT PUP2
    Chains: C, F
    EC Number: 3.4.25.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PGEX4T
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
    Synonym: MACROPAIN SUBUNIT PUP2, PROTEINASE YSCE SUBUNIT PUP2, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT PUP2, PROTEASOME SUBUNIT ALPHA 5

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABCDEF
Biological Unit 1 (1x): ABC   
Biological Unit 2 (1x):    DEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2Z5C)

(-) Sites  (0, 0)

(no "Site" information available for 2Z5C)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2Z5C)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Leu B:125 -Pro B:126
2Leu E:125 -Pro E:126

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2Z5C)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2Z5C)

(-) Exons   (3, 6)

Asymmetric Unit (3, 6)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1YGR253C1YGR253C.1VII:999145-998363783PSA5_YEAST1-2602602C:33-250 (gaps)
F:33-250 (gaps)		218
218
2.1YLR021W1YLR021W.1XII:183622-184161540POC3_YEAST1-1791792B:2-178 (gaps)
E:2-178 (gaps)		177
177
3.1YPL144W1YPL144W.1XVI:280479-280925447POC4_YEAST1-1481482A:4-147 (gaps)
D:4-147 (gaps)		144
144

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:124
 aligned with POC4_YEAST | Q12245 from UniProtKB/Swiss-Prot  Length:148

    Alignment length:144
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143    
           POC4_YEAST     4 KTISRTIESESGFLQPTLDVIATLPADDRSKKIPISLVVGFKQEASLNSSSSLSCYYYAIPLMRDRHINLKSGGSNVVGIPLLDTKDDRIRDMARHMATIISERFNRPCYVTWSSLPSEDPSMLVANHLYILKKCLDLLKTELG 147
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee..-----...eeeeee....---....eeeeeee...----...eeeeeeeeee.....--------..eeeeeee...hhhhhhhhhhhhhhhhhhhh..eeeeeee.....hhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 3 Exon 3.1  PDB: A:4-147 (gaps) UniProt: 1-148 [INCOMPLETE]                                                                                        Transcript 3
                 2z5c A   4 KTISRTIES-----QPTLDVIATLPAD---KKIPISLVVGFKQE----SSSSLSCYYYAIPLMRDR--------SNVVGIPLLDTKDDRIRDMARHMATIISERFNRPCYVTWSSLPSEDPSMLVANHLYILKKCLDLLKTELG 147
                                    |-    |   23      |  -|       43   |    53        63     |   -    |   83        93       103       113       123       133       143    
                                   12    18          30  34           47   52               69       78                                                                     


Chain B from PDB  Type:PROTEIN  Length:106
 aligned with POC3_YEAST | Q07951 from UniProtKB/Swiss-Prot  Length:179

    Alignment length:177
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       
           POC3_YEAST     2 ISYEFQTHLPKGKDSSLNASSENKELYVQATHFNNTILLQIRLNGEMDSTYEVSSKGLNPILDINVPLAGNLGNTGGDYDDEEEEFVRDHLSDYQVVTKLGDSADPKVPVVCVQIAELYRRVILPEVSGTMAQDNMQFSLLISMSSKIWRATKEQSADDNDFGKLVFVLKCIKDMYA 178
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.---------------..eeeeee.......eeeee.....eeeeee....-----------------------------------.eeeeee......hhhhhhhhhhhhhhh....-----------..eeeeee.hhhh----------..hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 2 Exon 2.1  PDB: B:2-178 (gaps) UniProt: 1-179 [INCOMPLETE]                                                                                                                         Transcript 2
                 2z5c B   2 ISYEFQTH---------------KELYVQATHFNNTILLQIRLNGEMDSTYEVSSKGL-----------------------------------YQVVTKLGDSADPKVPVVCVQIAELYRRVILP-----------QFSLLISMSSKIW----------NDFGKLVFVLKCIKDMYA 178
                                   | -         -   |    31        41        51       | -         -         -         -   |   101       111       121    |    -      |141        |-       161       171       
                                   9              25                                59                                  95                            126         138         150        161                 


Chain C from PDB  Type:PROTEIN  Length:189
 aligned with PSA5_YEAST | P32379 from UniProtKB/Swiss-Prot  Length:260

    Alignment length:218
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242        
           PSA5_YEAST    33 LGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAE 250
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee.....eeeeee..-----------..eeeee..eeeee.--...hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.----------------..eeeeeee...eeeeeee.....eeee.eeee..hhhhhhhhhhh......hhhhhhhhhhhhhhhhh........eeeeeee...eeee.hhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: C:33-250 (gaps) UniProt: 1-260 [INCOMPLETE]                                                                                                                                                                 Transcript 1
                 2z5c C  33 LGSTAIGIATKEGVVLGVEKR-----------EKIVEIDRHIGCAMS--TADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRF----------------VALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAE 250
                                    42        52|        -  |     72      | 82        92       102       112       122|        -       142       152       162       172       182       192       202       212       222       232       242        
                                               53          65            79 82                                      123              140                                                                                                              


Chain D from PDB  Type:PROTEIN  Length:124
 aligned with POC4_YEAST | Q12245 from UniProtKB/Swiss-Prot  Length:148

    Alignment length:144
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143    
           POC4_YEAST     4 KTISRTIESESGFLQPTLDVIATLPADDRSKKIPISLVVGFKQEASLNSSSSLSCYYYAIPLMRDRHINLKSGGSNVVGIPLLDTKDDRIRDMARHMATIISERFNRPCYVTWSSLPSEDPSMLVANHLYILKKCLDLLKTELG 147
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) chaperone     _DMP-2z5cD01    D:4-143                                                                                                       ---- Pfam domains (1)
           Pfam domains (2) chaperone     _DMP-2z5cD02    D:4-143                                                                                                       ---- Pfam domains (2)
         Sec.struct. author .eeeeee..-----...eeeeee....---....eeeeeee...----...eeeeeeeeee.....--------..eeeeeee...hhhhhhhhhhhhhhhhhhhh..eeeeeee.....hhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 3 Exon 3.1  PDB: D:4-147 (gaps) UniProt: 1-148 [INCOMPLETE]                                                                                        Transcript 3
                 2z5c D   4 KTISRTIES-----QPTLDVIATLPAD---KKIPISLVVGFKQE----SSSSLSCYYYAIPLMRDR--------SNVVGIPLLDTKDDRIRDMARHMATIISERFNRPCYVTWSSLPSEDPSMLVANHLYILKKCLDLLKTELG 147
                                    |-    |   23      |  -|       43   |    53        63     |   -    |   83        93       103       113       123       133       143    
                                   12    18          30  34           47   52               69       78                                                                     


Chain E from PDB  Type:PROTEIN  Length:106
 aligned with POC3_YEAST | Q07951 from UniProtKB/Swiss-Prot  Length:179

    Alignment length:177
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       
           POC3_YEAST     2 ISYEFQTHLPKGKDSSLNASSENKELYVQATHFNNTILLQIRLNGEMDSTYEVSSKGLNPILDINVPLAGNLGNTGGDYDDEEEEFVRDHLSDYQVVTKLGDSADPKVPVVCVQIAELYRRVILPEVSGTMAQDNMQFSLLISMSSKIWRATKEQSADDNDFGKLVFVLKCIKDMYA 178
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) chaperon               e_DMP-2z5cE01 E:2-174                                                                                                                                 ---- Pfam domains (1)
           Pfam domains (2) chaperon               e_DMP-2z5cE02 E:2-174                                                                                                                                 ---- Pfam domains (2)
         Sec.struct. author .eeeeee.---------------..eeeeee.......eeeee.....eeeeee....-----------------------------------.eeeeee.....hhhhhhhhhhhhhhhh....-----------..eeeeee.hhhh----------..hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 2 Exon 2.1  PDB: E:2-178 (gaps) UniProt: 1-179 [INCOMPLETE]                                                                                                                         Transcript 2
                 2z5c E   2 ISYEFQTH---------------KELYVQATHFNNTILLQIRLNGEMDSTYEVSSKGL-----------------------------------YQVVTKLGDSADPKVPVVCVQIAELYRRVILP-----------QFSLLISMSSKIW----------NDFGKLVFVLKCIKDMYA 178
                                   | -         -   |    31        41        51       | -         -         -         -   |   101       111       121    |    -      |141        |-       161       171       
                                   9              25                                59                                  95                            126         138         150        161                 


Chain F from PDB  Type:PROTEIN  Length:189
 aligned with PSA5_YEAST | P32379 from UniProtKB/Swiss-Prot  Length:260

    Alignment length:218
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242        
           PSA5_YEAST    33 LGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAE 250
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) Proteasome-2z5cF01 F:           33-222                                                                                                                                                        ---------------------------- Pfam domains (1)
           Pfam domains (2) Proteasome-2z5cF02 F:           33-222                                                                                                                                                        ---------------------------- Pfam domains (2)
         Sec.struct. author ....eeee.....eeeeee..-----------..eeeee..eeeee.--...hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.----------------..eeeeeee...eeeeeee.....eeee.eeee..hhhhhhhhhhh......hhhhhhhhhhhhhhhhh........eeeeeee...eeee.hhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: F:33-250 (gaps) UniProt: 1-260 [INCOMPLETE]                                                                                                                                                                 Transcript 1
                 2z5c F  33 LGSTAIGIATKEGVVLGVEKR-----------EKIVEIDRHIGCAMS--TADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRF----------------VALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAE 250
                                    42        52|        -  |     72      | 82        92       102       112       122|        -       142       152       162       172       182       192       202       212       222       232       242        
                                               53          65            79 82                                      123              140
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2Z5C)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2Z5C)

(-) Pfam Domains  (2, 6)

Asymmetric Unit
(-)
Clan: NTN (93)
(-)
Clan: no clan defined [family: chaperone_DMP] (2)

(-) Gene Ontology  (21, 27)

Asymmetric Unit(hide GO term definitions)
Chain A,D   (POC4_YEAST | Q12245)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
biological process
    GO:0051131    chaperone-mediated protein complex assembly    The aggregation, arrangement and bonding together of a set of components to form a protein complex, mediated by chaperone molecules that do not form part of the finished complex.
    GO:0043248    proteasome assembly    The aggregation, arrangement and bonding together of a mature, active proteasome complex.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

Chain B,E   (POC3_YEAST | Q07951)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
biological process
    GO:0051131    chaperone-mediated protein complex assembly    The aggregation, arrangement and bonding together of a set of components to form a protein complex, mediated by chaperone molecules that do not form part of the finished complex.
    GO:0070481    nuclear-transcribed mRNA catabolic process, non-stop decay    The chemical reactions and pathways resulting in the breakdown of the transcript body of a nuclear-transcribed mRNA that is lacking a stop codon.
    GO:0043248    proteasome assembly    The aggregation, arrangement and bonding together of a mature, active proteasome complex.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

Chain C,F   (PSA5_YEAST | P32379)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0004298    threonine-type endopeptidase activity    Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
biological process
    GO:0010499    proteasomal ubiquitin-independent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051603    proteolysis involved in cellular protein catabolic process    The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0042175    nuclear outer membrane-endoplasmic reticulum membrane network    The continuous network of membranes encompassing the nuclear outer membrane and the endoplasmic reticulum membrane.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0005839    proteasome core complex    A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
    GO:0019773    proteasome core complex, alpha-subunit complex    The proteasome core subcomplex that constitutes the two outer rings of the proteasome core complex. An example of this component is found in Mus musculus.
    GO:0034515    proteasome storage granule    A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2z5c)
 
  Sites
(no "Sites" information available for 2z5c)
 
  Cis Peptide Bonds
    Leu B:125 - Pro B:126   [ RasMol ]  
    Leu E:125 - Pro E:126   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2z5c
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  POC3_YEAST | Q07951
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  POC4_YEAST | Q12245
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSA5_YEAST | P32379
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.25.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  POC3_YEAST | Q07951
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  POC4_YEAST | Q12245
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSA5_YEAST | P32379
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        POC3_YEAST | Q07951: 2z5b
        POC4_YEAST | Q12245: 2z5b
        PSA5_YEAST | P32379: 1fnt 1g0u 1g65 1jd2 1ryp 1z7q 2f16 2fak 2gpl 2zcy 3bdm 3d29 3dy3 3dy4 3e47 3gpj 3gpt 3gpw 3hye 3jco 3jcp 3mg0 3mg4 3mg6 3mg7 3mg8 3nzj 3nzw 3nzx 3oeu 3oev 3okj 3sdi 3sdk 3shj 3tdd 3un4 3un8 3wxr 4cr2 4cr3 4cr4 4eu2 4fzc 4fzg 4g4s 4gk7 4hnp 4hrc 4hrd 4inr 4int 4inu 4j70 4jsq 4jsu 4jt0 4lqi 4ltc 4nnn 4nnw 4no1 4no6 4no8 4no9 4q1s 4qby 4qlq 4qls 4qlt 4qlu 4qlv 4qux 4quy 4qv0 4qv1 4qv3 4qv4 4qv5 4qv6 4qv7 4qv8 4qv9 4qvl 4qvm 4qvn 4qvp 4qvq 4qvv 4qvw 4qvy 4qw0 4qw1 4qw3 4qw4 4qw5 4qw6 4qw7 4qwf 4qwg 4qwi 4qwj 4qwk 4qwl 4qwr 4qws 4qwu 4qwx 4qxj 4qz0 4qz1 4qz2 4qz3 4qz4 4qz5 4qz6 4qz7 4qzw 4qzx 4qzz 4r00 4r02 4r17 4r18 4rur 4v7o 4x6z 4y69 4y6a 4y6v 4y6z 4y70 4y74 4y75 4y77 4y78 4y7w 4y7x 4y7y 4y80 4y81 4y82 4y84 4y8g 4y8h 4y8i 4y8j 4y8k 4y8l 4y8m 4y8n 4y8o 4y8p 4y8q 4y8r 4y8s 4y8t 4y8u 4y9y 4y9z 4ya0 4ya1 4ya2 4ya3 4ya4 4ya5 4ya7 4ya9 4z1l 4zzg 5a5b 5ahj 5bou 5bxl 5bxn 5cgf 5cgg 5cgh 5cgi 5cz4 5cz5 5cz6 5cz7 5cz8 5cz9 5cza 5d0s 5d0t 5d0v 5d0w 5d0x 5d0z 5dki 5dkj 5fg7 5fg9 5fga 5fgd 5fge 5fgf 5fgg 5fgh 5fgi 5fhs 5jhr 5jhs 5l52 5l54 5l55 5l5a 5l5b 5l5d 5l5e 5l5f 5l5h 5l5i 5l5j 5l5o 5l5p 5l5q 5l5r 5l5s 5l5t 5l5u 5l5v 5l5w 5l5x 5l5y 5l5z 5l60 5l61 5l62 5l63 5l64 5l65 5l66 5l67 5l68 5l69 5l6a 5l6b 5l6c 5lai 5laj 5ltt 5m2b 5mp9 5mpa 5mpb 5mpc 5wvi 5wvk

(-) Related Entries Specified in the PDB File

2z5b COMPLEXED WITH DMP1 AND DMP2