|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 4BME) |
Cis Peptide Bonds (5, 5)
Asymmetric Unit
|
||||||||||||||||||||||||
SAPs(SNPs)/Variants (3, 6)
Asymmetric Unit (3, 6)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (1, 2)
Asymmetric Unit (1, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (4, 8)
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:147 aligned with LEG8_HUMAN | O00214 from UniProtKB/Swiss-Prot Length:317 Alignment length:149 16 26 36 46 56 66 76 86 96 106 116 126 136 146 LEG8_HUMAN 7 NLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSS 155 SCOP domains d4bmea_ A: automated matches SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------Y----------------C-------------------V--------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------GALECTIN PDB: A:20-152 UniProt: 19-152 --- PROSITE Transcript 1 (1) Exon 1.6aExon 1.7b PDB: A:16-45 ----------------------------------------------------------------------Exon 1.9b PDB: A:116-155 Transcript 1 (1) Transcript 1 (2) --------------------------------------Exon 1.8b PDB: A:45-115 (gaps) UniProt: 45-115 ---------------------------------------- Transcript 1 (2) 4bme A 7 NLQNIIYNPVIPYVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFK--GCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSS 155 16 26 36 46 56 66 | |76 86 96 106 116 126 136 146 71 74 Chain B from PDB Type:PROTEIN Length:146 aligned with LEG8_HUMAN | O00214 from UniProtKB/Swiss-Prot Length:317 Alignment length:147 16 26 36 46 56 66 76 86 96 106 116 126 136 146 LEG8_HUMAN 7 NLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSF 153 SCOP domains d4bmeb_ B: automated matches SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------Y----------------C-------------------V------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------GALECTIN PDB: B:20-152 UniProt: 19-152 - PROSITE Transcript 1 (1) Exon 1.6aExon 1.7b PDB: B:16-45 ----------------------------------------------------------------------Exon 1.9b PDB: B:116-153 [INCOMPLETE] Transcript 1 (1) Transcript 1 (2) --------------------------------------Exon 1.8b PDB: B:45-115 (gaps) UniProt: 45-115 -------------------------------------- Transcript 1 (2) 4bme B 7 NLQNIIYNPVIPYVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITY-TPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSF 153 16 26 36 46 56 66 76 86 | 96 106 116 126 136 146 93 | 95
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 4BME) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 4BME) |
Gene Ontology (8, 8)|
Asymmetric Unit(hide GO term definitions) Chain A,B (LEG8_HUMAN | O00214)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|