|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (6, 9)| Asymmetric/Biological Unit (6, 9) |
Sites (9, 9)
Asymmetric Unit (9, 9)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3AP9) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (3, 3)
Asymmetric/Biological Unit (3, 3)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (4, 4)
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:151 aligned with LEG8_HUMAN | O00214 from UniProtKB/Swiss-Prot Length:317 Alignment length:151 13 23 33 43 53 63 73 83 93 103 113 123 133 143 153 LEG8_HUMAN 4 SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFS 154 SCOP domains d3ap9a_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------Y----------------C-------------------V-------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------GALECTIN PDB: A:19-152 UniProt: 19-152 -- PROSITE Transcript 1 (1) Exon 1.6a Exon 1.7b PDB: A:16-45 ----------------------------------------------------------------------Exon 1.9b PDB: A:116-154 [INCOMPLETE] Transcript 1 (1) Transcript 1 (2) -----------------------------------------Exon 1.8b PDB: A:45-115 UniProt: 45-115 --------------------------------------- Transcript 1 (2) 3ap9 A 4 SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSVKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFS 154 13 23 33 43 53 63 73 83 93 103 113 123 133 143 153
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3AP9) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3AP9) |
Gene Ontology (8, 8)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (LEG8_HUMAN | O00214)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|