|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (5, 6)| Asymmetric Unit (5, 6) Biological Unit 1 (2, 24) |
Sites (6, 6)
Asymmetric Unit (6, 6)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 4B2H) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 4B2H) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 4B2H) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 4B2H) |
Exons (0, 0)| (no "Exon" information available for 4B2H) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:62 aligned with DODEC_HALS3 | B0R5M0 from UniProtKB/Swiss-Prot Length:68 Alignment length:64 11 21 31 41 51 61 DODEC_HALS3 2 VFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVEIGAVEERTYQTEVQVAFELD 65 SCOP domains d4b2ha_ A: automated matches SCOP domains CATH domains ---------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------- Transcript 4b2h A 2 VFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVAIGAV--RTYQTEVQVAFELD 63 11 21 31 41 | -| 59 49 50
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 4B2H) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 4B2H) |
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A (DODEC_HALS3 | B0R5M0)
|
||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|