|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (5, 7)| Asymmetric Unit (5, 7) Biological Unit 1 (2, 24) |
Sites (7, 7)
Asymmetric Unit (7, 7)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2CC7) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2CC7) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2CC7) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2CC7) |
Exons (0, 0)| (no "Exon" information available for 2CC7) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:64 aligned with DODEC_HALS3 | B0R5M0 from UniProtKB/Swiss-Prot Length:68 Alignment length:64 11 21 31 41 51 61 DODEC_HALS3 2 VFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVEIGAVEERTYQTEVQVAFELD 65 SCOP domains d2cc7a_ A: automated matches SCOP domains CATH domains 2cc7A00 A:2-65 Flavin-binding protein dodecin CATH domains Pfam domains ---------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------- Transcript 2cc7 A 2 VFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVEIGAVEERTYQTEVQVAFELD 65 11 21 31 41 51 61 Chain A from PDB Type:PROTEIN Length:64 aligned with Q9HPW4_HALSA | Q9HPW4 from UniProtKB/TrEMBL Length:77 Alignment length:64 20 30 40 50 60 70 Q9HPW4_HALSA 11 VFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVEIGAVEERTYQTEVQVAFELD 74 SCOP domains d2cc7a_ A: automated matches SCOP domains CATH domains 2cc7A00 A:2-65 Flavin-binding protein dodecin CATH domains Pfam domains ---------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------- Transcript 2cc7 A 2 VFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVEIGAVEERTYQTEVQVAFELD 65 11 21 31 41 51 61
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2CC7) |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A (Q9HPW4_HALSA | Q9HPW4)
Chain A (DODEC_HALS3 | B0R5M0)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|