Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  DIABODY 305 COMPLEX WITH EPOR
 
Authors :  I. Moraga, F. Guo, E. Ozkan, K. M. Jude, K. C. Garcia
Date :  12 Feb 15  (Deposition) - 29 Apr 15  (Release) - 29 Apr 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I
Biol. Unit 1:  A,B,C,D,E,F  (1x)
Biol. Unit 2:  G,H,I  (2x)
Keywords :  Diabody Complex, Receptor, Protein Binding-Immune System Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  I. Moraga, G. Wernig, S. Wilmes, V. Gryshkova, C. P. Richter, W. J. Hong R. Sinha, F. Guo, H. Fabionar, T. S. Wehrman, P. Krutzik, S. Demharter, I. Plo, I. L. Weissman, P. Minary, R. Majeti, S. N. Constantinescu, J. Piehler, K. C. Garcia
Tuning Cytokine Receptor Signaling By Re-Orienting Dimer Geometry With Surrogate Ligands.
Cell V. 160 1196 2015
PubMed-ID: 25728669  |  Reference-DOI: 10.1016/J.CELL.2015.02.011

(-) Compounds

Molecule 1 - DIABODY 305 VH DOMAIN
    Chains: A, D, G
    Engineered: YES
    Expression System: TRICHOPLUSIA NI
    Expression System Taxid: 7111
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
 
Molecule 2 - DIABODY 305 VL DOMAIN
    Chains: B, E, H
    Engineered: YES
    Expression System: TRICHOPLUSIA NI
    Expression System Taxid: 7111
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
 
Molecule 3 - ERYTHROPOIETIN RECEPTOR
    Chains: C, F, I
    Engineered: YES
    Expression System: TRICHOPLUSIA NI
    Expression System Taxid: 7111
    Gene: EPOR
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: EPO-R

 Structural Features

(-) Chains, Units

  123456789
Asymmetric Unit : ABCDEFGHI
Biological Unit 1 (1x): ABCDEF   
Biological Unit 2 (2x):       GHI

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 17)

Asymmetric Unit (3, 17)
No.NameCountTypeFull Name
1GOL15Ligand/IonGLYCEROL
2PEG1Ligand/IonDI(HYDROXYETHYL)ETHER
3PGE1Ligand/IonTRIETHYLENE GLYCOL
Biological Unit 1 (3, 12)
No.NameCountTypeFull Name
1GOL10Ligand/IonGLYCEROL
2PEG1Ligand/IonDI(HYDROXYETHYL)ETHER
3PGE1Ligand/IonTRIETHYLENE GLYCOL
Biological Unit 2 (1, 10)
No.NameCountTypeFull Name
1GOL10Ligand/IonGLYCEROL
2PEG-1Ligand/IonDI(HYDROXYETHYL)ETHER
3PGE-1Ligand/IonTRIETHYLENE GLYCOL

(-) Sites  (17, 17)

Asymmetric Unit (17, 17)
No.NameEvidenceResiduesDescription
01AC1SOFTWARESER A:106 , ASP A:107 , TRP A:108 , HOH A:301 , PRO B:46 , LYS B:47binding site for residue GOL A 201
02AC2SOFTWAREGLN B:40 , HIS B:41 , GLY B:43 , LYS B:44 , HOH B:302binding site for residue GOL B 201
03AC3SOFTWAREASP B:52 , ARG B:55 , GLU C:34 , THR C:87 , THR C:90binding site for residue GOL B 202
04AC4SOFTWAREGLY A:42 , LYS A:43 , GLY A:44 , ASP B:87 , TYR B:89 , GLY B:103 , GLY B:104binding site for residue GOL B 203
05AC5SOFTWAREASP D:54 , ARG D:72 , ASP D:73 , ASN D:74 , GOL D:202 , HOH D:331binding site for residue GOL D 201
06AC6SOFTWAREILE D:51 , LYS D:58 , SER D:71 , ARG D:72 , GOL D:201binding site for residue GOL D 202
07AC7SOFTWARESER D:56 , GLU D:57 , LYS D:58 , TYR D:60 , THR D:69 , LEU G:11 , SER G:118binding site for residue PGE D 203
08AC8SOFTWARESER A:71 , ARG A:72 , LEU D:113 , THR D:115binding site for residue PEG D 204
09AC9SOFTWAREGLN D:39 , GLY D:42 , GLN E:40 , GLY E:43 , LYS E:44binding site for residue GOL E 201
10AD1SOFTWAREILE E:33 , ASP E:52 , ARG E:55 , THR F:87 , THR F:90 , SER F:91binding site for residue GOL E 202
11AD2SOFTWAREGLY D:42 , TYR E:89 , GLY E:103 , GLY E:104 , THR E:105binding site for residue GOL E 203
12AD3SOFTWARETRP C:212 , SER C:213 , GLU C:214 , ARG F:191 , SER F:217binding site for residue GOL F 301
13AD4SOFTWAREGLN A:13 , ARG D:87 , LYS G:65 , GLY G:66 , PHE G:68 , THR G:69 , HOH G:314binding site for residue GOL G 201
14AD5SOFTWAREGLY A:120 , SER G:56 , GLU G:57 , LYS G:58binding site for residue GOL G 202
15AD6SOFTWAREGLY G:42 , TYR G:95 , HOH G:315 , GLN H:40 , GLY H:43 , LYS H:44binding site for residue GOL H 201
16AD7SOFTWAREGLY G:42 , TYR H:89 , GLY H:103 , GLY H:104 , THR H:105binding site for residue GOL H 202
17AD8SOFTWARETRP G:108 , ALA H:45 , PRO H:46binding site for residue GOL H 203

(-) SS Bonds  (12, 12)

Asymmetric Unit
No.Residues
1A:22 -A:96
2B:22 -B:90
3C:28 -C:38
4C:67 -C:83
5D:22 -D:96
6E:22 -E:90
7F:28 -F:38
8F:67 -F:83
9G:22 -G:96
10H:22 -H:90
11I:28 -I:38
12I:67 -I:83

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4Y5V)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4Y5V)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4Y5V)

(-) Exons   (0, 0)

(no "Exon" information available for 4Y5V)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:121
                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..eee.....eeeeeeee..hhhhh.eeeeee.....eeeeeee......eee.hhhh..eeeeee....eeeeee...hhhhheeeeeeee.hhh.eeee...eeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript
                 4y5v A   0 SEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANIKPDGSEKYYVDSVKGRFTISRDNAKNSVYLQMNSLRAEDTAVYYCARVSRGGSYSDWGQGTLVTVSSGG 120
                                     9        19        29        39        49        59        69        79        89        99       109       119 


Chain B from PDB  Type:PROTEIN  Length:111
                                                                                                                                               
               SCOP domains --------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeee.....eeeeee...........eeeeee......eeee.............eeeeee..eeeeee...hhhhh.eeeeeee.....eee...eeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------- Transcript
                 4y5v B   0 SQSALTQPASVSGSPGQSITISCTGTSSDVGGYIYVSWYQQHPGKAPKLMIYDVSRRPSGISDRFSGSKSGNTASLTISGLQAEDEADYYCNSYTTLSTWLFGGGTKVTVL 110
                                     9        19        29        39        49        59        69        79        89        99       109 


Chain C from PDB  Type:PROTEIN  Length:206
                                                                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhh.....eee.......eeeeee....eeeeeee.....eee.eeeee....eeeeee.hhhhh.....eeeeeee....eeeeeeehhhhh......eeeeeee......eeeeee......hhh.eeeeeeeee....eeeeee.....eeee.......eeeeeeeeee...............eeee.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4y5v C   9 PKFESKAALLAARGPEELLCFTERLEDLVCFWEEAPGQYSFSYQLEDEPWKLCRLHQAPTAGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGQGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSD 223
                                    18        28        38    ||  54        64        74||      85        95       105       115       125       135       145       155       165|      177       187       197       207       217      
                                                             43|                       75|                                                                                     165|                                                       
                                                              50                        77                                                                                      168                                                       


Chain D from PDB  Type:PROTEIN  Length:122
                                                                                                                                                          
               SCOP domains -------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..eee.....eeeeeeee..hhhhh.eeeeee.....eeeeeee......eee.hhhh..eeeeee....eeeeee...hhhhheeeeeeee.hhh.eeee...eeeee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript
                 4y5v D   0 SEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANIKPDGSEKYYVDSVKGRFTISRDNAKNSVYLQMNSLRAEDTAVYYCARVSRGGSYSDWGQGTLVTVSSGGG 121
                                     9        19        29        39        49        59        69        79        89        99       109       119  


Chain E from PDB  Type:PROTEIN  Length:112
                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeee.....eeeeee...........eeeeee......eeee.............eeeeee..eeeeee...hhhhh.eeeeeee.....eee...eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------- Transcript
                 4y5v E   0 SQSALTQPASVSGSPGQSITISCTGTSSDVGGYIYVSWYQQHPGKAPKLMIYDVSRRPSGISDRFSGSKSGNTASLTISGLQAEDEADYYCNSYTTLSTWLFGGGTKVTVLA 111
                                     9        19        29        39        49        59        69        79        89        99       109  


Chain F from PDB  Type:PROTEIN  Length:206
                                                                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhh.....eee.......eeeeee.....eeeeeee.....eee..eeeee...eeeeeee.hhhhh.....eeeeeee....eeeeeeehhhhh......eeeeeee.....eeeeee......hhh.eeeeeeee....eeeeee.....eeee.......eeeeeeeeee...............eeee.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4y5v F   9 PKFESKAALLAARGPEELLCFTERLEDLVCFWEEAAPGQYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLAESGHVVLRWLPPPETPMTSHIRYEVDVSAGQSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSD 223
                                    18        28        38     || 53        63        73        83        93       103       113       123       134       144       154       164|      177       187       197       207       217      
                                                              44|                                                                               132|                           164|                                                       
                                                               50                                                                                134                            168                                                       


Chain G from PDB  Type:PROTEIN  Length:119
                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..eee.....eeeeeeee..hhhhh.eeeeee.....eeeeeee......eee.hhhh..eeeeee....eeeeee...hhhhheeeeeeee.hhh.eeee...eeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                 4y5v G   0 SEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANIKPDGSEKYYVDSVKGRFTISRDNAKNSVYLQMNSLRAEDTAVYYCARVSRGGSYSDWGQGTLVTVSS 118
                                     9        19        29        39        49        59        69        79        89        99       109         


Chain H from PDB  Type:PROTEIN  Length:112
                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeee.....eeeeee...........eeeeee......eeee.............eeeeee..eeeeee...hhhhh.eeeeeee.....eee...eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------- Transcript
                 4y5v H   0 SQSALTQPASVSGSPGQSITISCTGTSSDVGGYIYVSWYQQHPGKAPKLMIYDVSRRPSGISDRFSGSKSGNTASLTISGLQAEDEADYYCNSYTTLSTWLFGGGTKVTVLA 111
                                     9        19        29        39        49        59        69        79        89        99       109  


Chain I from PDB  Type:PROTEIN  Length:191
                                                                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh......eee.......eeeeee.....eeeeeee.....eee..eee...eeeeee.hhhhh.....eeeeeee....eeeeeeehhhhh......eeeeee....eeeeee......hhh.eeeeeeee..eeeee.....eeee......eeeeeeeee...............eee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4y5v I  10 KFESKAALLAARGPEELLCFTERLEDLVCFWEEAAPGQYSFSYQLEDEPWKLCRLHQAPTAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLSGHVVLRWLPPPETPMTSHIRYEVDVSAVQRVEILEGRTECVLSNGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLL 219
                                    19        29        39    ||  54        64        74|       87        97       107       117       127   ||  140       150       160 ||    176       188       198       208       218 
                                                             44|                      74|                                                  131|                        162|             185|                               
                                                              50                       78                                                   135                         169              188
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4Y5V)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4Y5V)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4Y5V)

(-) Gene Ontology  (24, 24)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PGE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4y5v)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4y5v
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  EPOR_HUMAN | P19235
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  EPOR_HUMAN | P19235
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        EPOR_HUMAN | P19235: 1cn4 1eba 1ebp 1eer 1ern 2jix 2mv6 4y5x 4y5y

(-) Related Entries Specified in the PDB File

4y5x 4y5y