Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  COMPLEX BETWEEN THE EXTRACELLULAR DOMAIN OF ERYTHROPOIETIN (EPO) RECEPTOR [EBP] AND AN AGONIST PEPTIDE [EMP1]
 
Authors :  O. Livnah, E. A. Stura, I. A. Wilson
Date :  07 May 96  (Deposition) - 29 Jul 97  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Erythropoietin Receptor, Signal Transduction, Protein Minimization, Drug Design, Cytokine Receptor Class 1, Complex (Cytokine Receptor/Peptide) (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  O. Livnah, E. A. Stura, D. L. Johnson, S. A. Middleton, L. S. Mulcahy, N. C. Wrighton, W. J. Dower, L. K. Jolliffe, I. A. Wilson
Functional Mimicry Of A Protein Hormone By A Peptide Agonist: The Epo Receptor Complex At 2. 8 A.
Science V. 273 464 1996
PubMed-ID: 8662530
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - EPO RECEPTOR
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentEXTRACELLULAR DOMAIN
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymEBP
 
Molecule 2 - EPO MIMETICS PEPTIDE 1
    ChainsC, D
    EngineeredYES
    SynonymEMP1, RWJ 61233

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1EBP)

(-) Sites  (0, 0)

(no "Site" information available for 1EBP)

(-) SS Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1A:28 -A:38
2A:67 -A:83
3B:28 -B:38
4B:67 -B:83
5C:6 -C:15
6D:6 -D:15

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Glu A:202 -Pro A:203
2Glu B:202 -Pro B:203

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1EBP)

(-) PROSITE Motifs  (2, 4)

Asymmetric/Biological Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FN3PS50853 Fibronectin type-III domain profile.EPOR_HUMAN147-247
 
  2A:123-220
B:123-220
2HEMATOPO_REC_L_F1PS01352 Long hematopoietin receptor, single chain family signature.EPOR_HUMAN162-242
 
  2A:138-218
B:138-218

(-) Exons   (5, 10)

Asymmetric/Biological Unit (5, 10)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002221391ENSE00001338639chr19:11495019-11494769251EPOR_HUMAN1-39392A:10-15
B:10-15
6
6
1.2ENST000002221392ENSE00001246294chr19:11493908-11493773136EPOR_HUMAN39-84462A:15-60
B:15-60
46
46
1.3ENST000002221393ENSE00001185968chr19:11492781-11492606176EPOR_HUMAN84-143602A:60-119
B:60-119
60
60
1.4ENST000002221394ENSE00000680536chr19:11492525-11492368158EPOR_HUMAN143-195532A:119-171
B:119-171
53
53
1.5ENST000002221395ENSE00000680533chr19:11491885-11491732154EPOR_HUMAN196-247522A:172-220
B:172-220
49
49
1.6ENST000002221396ENSE00000680531chr19:11491647-1149156088EPOR_HUMAN247-276300--
1.7ENST000002221397ENSE00000680529chr19:11489454-1148936788EPOR_HUMAN276-305300--
1.8ENST000002221398ENSE00001131148chr19:11489271-11488475797EPOR_HUMAN306-5082030--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:211
 aligned with EPOR_HUMAN | P19235 from UniProtKB/Swiss-Prot  Length:508

    Alignment length:211
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243 
           EPOR_HUMAN    34 KFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLT 244
               SCOP domains d1ebpa1 A:10-116 Erythropoietin (EPO) receptor                                                             d1ebpa2 A:117-220 Erythropoietin (EPO) receptor                                                          SCOP domains
               CATH domains ------------1ebpA01 A:22-118 Immunoglobulins                                                                 1ebpA02 A:119-220 Immunoglobulins                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh........eee.......eeeeeee......hhheeeeeee.....eee..eeee....eeeeeee..hhh......eeeeeee....eeeeeee.hhh..........eeeee....eeeee.........hhheeeeeeeee.......eeeee.....eeee.......eeeeeeeeee...............eeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -----------------------------------------------------------------------------------------------------------------FN3  PDB: A:123-220 UniProt: 147-247                                                               PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------HEMATOPO_REC_L_F1  PDB: A:138-218 UniProt: 162-242                               -- PROSITE (2)
           Transcript 1 (1) 1.1   --------------------------------------------Exon 1.3  PDB: A:60-119 UniProt: 84-143                     ----------------------------------------------------Exon 1.5  PDB: A:172-220 UniProt: 196-247         Transcript 1 (1)
           Transcript 1 (2) -----Exon 1.2  PDB: A:15-60 UniProt: 39-84         ----------------------------------------------------------Exon 1.4  PDB: A:119-171 UniProt: 143-195            ------------------------------------------------- Transcript 1 (2)
                 1ebp A  10 KFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLT 220
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219 

Chain B from PDB  Type:PROTEIN  Length:211
 aligned with EPOR_HUMAN | P19235 from UniProtKB/Swiss-Prot  Length:508

    Alignment length:211
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243 
           EPOR_HUMAN    34 KFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLT 244
               SCOP domains d1ebpb1 B:10-116 Erythropoietin (EPO) receptor                                                             d1ebpb2 B:117-220 Erythropoietin (EPO) receptor                                                          SCOP domains
               CATH domains ------------1ebpB01 B:22-118 Immunoglobulins                                                                 1ebpB02 B:119-220 Immunoglobulins                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh........eee......eeeeeee.......hhheeeeeee.....eee..eeee.....eeeeeee.hhh.....eeeeeeee....eeeeeeeehhh..........eeee......eeee.........hhheeeeeeeee........eeee.....eeee........eeeeeeeee...............eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -----------------------------------------------------------------------------------------------------------------FN3  PDB: B:123-220 UniProt: 147-247                                                               PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------HEMATOPO_REC_L_F1  PDB: B:138-218 UniProt: 162-242                               -- PROSITE (2)
           Transcript 1 (1) 1.1   --------------------------------------------Exon 1.3  PDB: B:60-119 UniProt: 84-143                     ----------------------------------------------------Exon 1.5  PDB: B:172-220 UniProt: 196-247         Transcript 1 (1)
           Transcript 1 (2) -----Exon 1.2  PDB: B:15-60 UniProt: 39-84         ----------------------------------------------------------Exon 1.4  PDB: B:119-171 UniProt: 143-195            ------------------------------------------------- Transcript 1 (2)
                 1ebp B  10 KFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLT 220
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219 

Chain C from PDB  Type:PROTEIN  Length:16
                                                
               SCOP domains d1ebpc_ C:       SCOP domains
               CATH domains ---------------- CATH domains
               Pfam domains ---------------- Pfam domains
         Sec.struct. author .eee............ Sec.struct. author
                 SAPs(SNPs) ---------------- SAPs(SNPs)
                    PROSITE ---------------- PROSITE
                 Transcript ---------------- Transcript
                 1ebp C   3 TYSCHFGPLTWVCKPQ  18
                                    12      

Chain D from PDB  Type:PROTEIN  Length:16
                                                
               SCOP domains d1ebpd_ D:       SCOP domains
               CATH domains ---------------- CATH domains
               Pfam domains ---------------- Pfam domains
         Sec.struct. author .eee............ Sec.struct. author
                 SAPs(SNPs) ---------------- SAPs(SNPs)
                    PROSITE ---------------- PROSITE
                 Transcript ---------------- Transcript
                 1ebp D   3 TYSCHFGPLTWVCKPQ  18
                                    12      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 6)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1EBP)

(-) Gene Ontology  (24, 24)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (EPOR_HUMAN | P19235)
molecular function
    GO:0004896    cytokine receptor activity    Combining with a cytokine and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0004900    erythropoietin receptor activity    Combining with erythropoietin and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004888    transmembrane signaling receptor activity    Combining with an extracellular or intracellular signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity or state as part of signal transduction.
biological process
    GO:0007420    brain development    The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.).
    GO:0019221    cytokine-mediated signaling pathway    A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0046697    decidualization    The cellular and vascular changes occurring in the endometrium of the pregnant uterus just after the onset of blastocyst implantation. This process involves the proliferation and differentiation of the fibroblast-like endometrial stromal cells into large, polyploid decidual cells that eventually form the maternal component of the placenta.
    GO:0038162    erythropoietin-mediated signaling pathway    A series of molecular signals initiated by the binding of erythropoietin (EPO) to the erythropoietin receptor (EPO-R) on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0007507    heart development    The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
    GO:1903206    negative regulation of hydrogen peroxide-induced cell death    Any process that stops, prevents or reduces the frequency, rate or extent of hydrogen peroxide-induced cell death.
    GO:0043524    negative regulation of neuron apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process in neurons.
    GO:0070374    positive regulation of ERK1 and ERK2 cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0007204    positive regulation of cytosolic calcium ion concentration    Any process that increases the concentration of calcium ions in the cytosol.
    GO:0010976    positive regulation of neuron projection development    Any process that increases the rate, frequency or extent of neuron projection development. Neuron projection development is the process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ebp)
 
  Sites
(no "Sites" information available for 1ebp)
 
  Cis Peptide Bonds
    Glu A:202 - Pro A:203   [ RasMol ]  
    Glu B:202 - Pro B:203   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ebp
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  EPOR_HUMAN | P19235
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  0014
    Age Related InformationGenAge
  0052
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  EPOR_HUMAN | P19235
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        EPOR_HUMAN | P192351cn4 1eba 1eer 1ern 2jix 2mv6 4y5v 4y5x 4y5y

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1EBP)