Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  INSULIN PROTEIN CRYSTALLIZATION VIA LANGMUIR-BLODGETT
 
Authors :  L. Belmonte, E. Pechkova, N. Bragazzi, C. Nicolini
Date :  29 Nov 12  (Deposition) - 20 Nov 13  (Release) - 20 Nov 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Langmuir Blodgett, Thin Films, Optimal Crystallization, Space Grown, Hormone (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. Pechkova, N. Bragazzi, L. Belmonte, C. Nicolini
A Review Of The Strategies For Obtaining High Quality Crystals Utilizing Nanotechnologies And Space
Crit. Rev. Eukaryot. Gene Expr. 2013
PubMed: search

(-) Compounds

Molecule 1 - INSULIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System CommonHUMAN
    Expression System Taxid562
    FragmentUNP RESIDUES 85-105
    GeneINS
    Organism CommonBOVINE,COW,DOMESTIC CATTLE,DOMESTIC COW
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    SynonymINSULIN B CHAIN, INSULIN A CHAIN
 
Molecule 2 - INSULIN
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System CommonHUMAN
    Expression System Taxid562
    FragmentUNP RESIDUES 25-54
    GeneINS
    Organism CommonBOVINE,COW,DOMESTIC CATTLE,DOMESTIC COW
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    SynonymINSULIN B CHAIN, INSULIN A CHAIN

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4I5Y)

(-) Sites  (0, 0)

(no "Site" information available for 4I5Y)

(-) SS Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1A:6 -A:11
2A:7 -B:7
3A:20 -B:19

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4I5Y)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4I5Y)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4I5Y)

(-) Exons   (0, 0)

(no "Exon" information available for 4I5Y)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:21
                                                    
               SCOP domains --------------------- SCOP domains
               CATH domains --------------------- CATH domains
               Pfam domains --------------------- Pfam domains
         Sec.struct. author hhhhhhh....hhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------- SAPs(SNPs)
                    PROSITE --------------------- PROSITE
                 Transcript --------------------- Transcript
                  4i5y A  1 GIVEQCCASVCSLYQLENYCN 21
                                    10        20 

Chain B from PDB  Type:PROTEIN  Length:30
                                                             
               SCOP domains ------------------------------ SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains ------------------------------ Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                  4i5y B  1 FVNQHLCGSHLVEALYLVCGERGFFYTPKA 30
                                    10        20        30

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4I5Y)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4I5Y)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4I5Y)

(-) Gene Ontology  (33, 33)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4i5y)
 
  Sites
(no "Sites" information available for 4i5y)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4i5y)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4i5y
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  INS_BOVIN | P01317
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  INS_BOVIN | P01317
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        INS_BOVIN | P013171aph 1bph 1cph 1dph 1ho0 1pid 2a3g 2bn1 2bn3 2ins 2zp6 3w14 4bs3 4e7t 4e7u 4e7v 4i5z 4idw 4ihn 4m4f 4m4h 4m4i 4m4j 4m4l 4m4m 5azz 5miz

(-) Related Entries Specified in the PDB File

2bn1 4i5z