Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  THE STRUCTURE OF T6 BOVINE INSULIN
 
Authors :  G. D. Smith, W. A. Pangborn, R. H. Blessing
Date :  24 Jun 05  (Deposition) - 25 Oct 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.25
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B,C,D  (3x)
Keywords :  Hormone, Insulin Family, Carbohydrate Metabolism, Hormone-Growth Factor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. D. Smith, W. A. Pangborn, R. H. Blessing
The Structure Of T6 Bovine Insulin.
Acta Crystallogr. , Sect. D V. 61 1476 2005
PubMed-ID: 16239724  |  Reference-DOI: 10.1107/S0907444905025771
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - INSULIN
    ChainsA, C
    FragmentINSULIN A CHAIN, RESIDUES 85-105
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
 
Molecule 2 - INSULIN
    ChainsB, D
    FragmentINSULIN B CHAIN, RESIDUES 25-54
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (3x)ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1ZN2Ligand/IonZINC ION
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1ZN-1Ligand/IonZINC ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS B:10 , HOH B:503BINDING SITE FOR RESIDUE ZN B 501
2AC2SOFTWAREHIS D:10 , HOH D:504BINDING SITE FOR RESIDUE ZN D 502

(-) SS Bonds  (6, 6)

Asymmetric Unit
No.Residues
1A:6 -A:11
2A:7 -B:7
3A:20 -B:19
4C:6 -C:11
5C:7 -D:7
6C:20 -D:19

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2A3G)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2A3G)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1INSULINPS00262 Insulin family signature.INS_BOVIN90-104
 
  2A:6-20
C:6-20
Biological Unit 1 (1, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1INSULINPS00262 Insulin family signature.INS_BOVIN90-104
 
  6A:6-20
C:6-20

(-) Exons   (0, 0)

(no "Exon" information available for 2A3G)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:21
 aligned with INS_BOVIN | P01317 from UniProtKB/Swiss-Prot  Length:105

    Alignment length:21
                                    94       104 
            INS_BOVIN    85 GIVEQCCASVCSLYQLENYCN 105
               SCOP domains --------------------- SCOP domains
               CATH domains --------------------- CATH domains
               Pfam domains --------------------- Pfam domains
         Sec.struct. author hhhhhhhhh..hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------- SAPs(SNPs)
                    PROSITE -----INSULIN        - PROSITE
                 Transcript --------------------- Transcript
                 2a3g A   1 GIVEQCCASVCSLYQLENYCN  21
                                    10        20 

Chain B from PDB  Type:PROTEIN  Length:30
 aligned with INS_BOVIN | P01317 from UniProtKB/Swiss-Prot  Length:105

    Alignment length:30
                                    34        44        54
            INS_BOVIN    25 FVNQHLCGSHLVEALYLVCGERGFFYTPKA  54
               SCOP domains ------------------------------ SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains ------------------------------ Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhheee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                 2a3g B   1 FVNQHLCGSHLVEALYLVCGERGFFYTPKA  30
                                    10        20        30

Chain C from PDB  Type:PROTEIN  Length:21
 aligned with INS_BOVIN | P01317 from UniProtKB/Swiss-Prot  Length:105

    Alignment length:21
                                    94       104 
            INS_BOVIN    85 GIVEQCCASVCSLYQLENYCN 105
               SCOP domains --------------------- SCOP domains
               CATH domains --------------------- CATH domains
               Pfam domains --------------------- Pfam domains
         Sec.struct. author hhhhhhh....hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------- SAPs(SNPs)
                    PROSITE -----INSULIN        - PROSITE
                 Transcript --------------------- Transcript
                 2a3g C   1 GIVEQCCASVCSLYQLENYCN  21
                                    10        20 

Chain D from PDB  Type:PROTEIN  Length:30
 aligned with INS_BOVIN | P01317 from UniProtKB/Swiss-Prot  Length:105

    Alignment length:30
                                    34        44        54
            INS_BOVIN    25 FVNQHLCGSHLVEALYLVCGERGFFYTPKA  54
               SCOP domains ------------------------------ SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains ------------------------------ Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhheee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                 2a3g D   1 FVNQHLCGSHLVEALYLVCGERGFFYTPKA  30
                                    10        20        30

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2A3G)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2A3G)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2A3G)

(-) Gene Ontology  (33, 33)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (INS_BOVIN | P01317)
molecular function
    GO:0005179    hormone activity    The action characteristic of a hormone, any substance formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells in the same organism, upon which it has a specific regulatory action. The term was originally applied to agents with a stimulatory physiological action in vertebrate animals (as opposed to a chalone, which has a depressant action). Usage is now extended to regulatory compounds in lower animals and plants, and to synthetic substances having comparable effects; all bind receptors and trigger some biological process.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005158    insulin receptor binding    Interacting selectively and non-covalently with the insulin receptor.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0035938    estradiol secretion    The regulated release of estradiol into the circulatory system.
    GO:0007631    feeding behavior    Behavior associated with the intake of food.
    GO:0044381    glucose import in response to insulin stimulus    The directed movement of the hexose monosaccharide glucose into a cell as a result of an insulin stimulus.
    GO:0006006    glucose metabolic process    The chemical reactions and pathways involving glucose, the aldohexose gluco-hexose. D-glucose is dextrorotatory and is sometimes known as dextrose; it is an important source of energy for living organisms and is found free as well as combined in homo- and hetero-oligosaccharides and polysaccharides.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0032099    negative regulation of appetite    Any process that reduces appetite.
    GO:1903488    negative regulation of lactation    Any process that stops, prevents or reduces the frequency, rate or extent of lactation.
    GO:0050995    negative regulation of lipid catabolic process    Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of lipids.
    GO:0035025    positive regulation of Rho protein signal transduction    Any process that activates or increases the frequency, rate or extent of Rho protein signal transduction.
    GO:1903524    positive regulation of blood circulation    Any process that activates or increases the frequency, rate or extent of blood circulation.
    GO:1903431    positive regulation of cell maturation    Any process that activates or increases the frequency, rate or extent of cell maturation.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0032024    positive regulation of insulin secretion    Any process that activates or increases the frequency, rate or extent of the regulated release of insulin.
    GO:1903489    positive regulation of lactation    Any process that activates or increases the frequency, rate or extent of lactation.
    GO:0033601    positive regulation of mammary gland epithelial cell proliferation    Any process that activates or increases the rate or extent of mammary gland epithelial cell proliferation.
    GO:0090277    positive regulation of peptide hormone secretion    Any process that increases the rate, frequency, or extent of the regulated release of a peptide hormone from secretory granules.
    GO:0014068    positive regulation of phosphatidylinositol 3-kinase signaling    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
    GO:0050714    positive regulation of protein secretion    Any process that activates or increases the frequency, rate or extent of the controlled release of a protein from a cell.
    GO:0009306    protein secretion    The controlled release of proteins from a cell.
    GO:1903576    response to L-arginine    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a L-arginine stimulus.
    GO:1903544    response to butyrate    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a butyrate stimulus.
    GO:0032094    response to food    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a food stimulus; food is anything which, when taken into the body, serves to nourish or build up the tissues or to supply body heat.
    GO:0009749    response to glucose    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucose stimulus.
    GO:0060416    response to growth hormone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a growth hormone stimulus. Growth hormone is a peptide hormone that binds to the growth hormone receptor and stimulates growth.
    GO:0009408    response to heat    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a heat stimulus, a temperature stimulus above the optimal temperature for that organism.
    GO:0031667    response to nutrient levels    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus reflecting the presence, absence, or concentration of nutrients.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2a3g)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2a3g
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  INS_BOVIN | P01317
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  INS_BOVIN | P01317
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        INS_BOVIN | P013171aph 1bph 1cph 1dph 1ho0 1pid 2bn1 2bn3 2ins 2zp6 3w14 4bs3 4e7t 4e7u 4e7v 4i5y 4i5z 4idw 4ihn 4m4f 4m4h 4m4i 4m4j 4m4l 4m4m 5azz 5miz

(-) Related Entries Specified in the PDB File

1mso CRYSTAL STRUCTURE OF T6 HUMAN INSULIN
1os3 DEHYDRATED T6 HUMAN INSULIN AT 100K
1os4 DEHYDRATED T6 HUMAN INSULIN AT 295K
4ins CRYSTAL STRUCTURE OF 2ZN PORCINE INSULIN