4CVS - JenaLib

Title :   STRUCTURE OF APOBACTERIOFERRITIN Y45F VARIANT

Authors :   K. Hingorani, R. Pace, S. Whitney, J. W. Murray, T. Wydrzynski, M. H. Che P. Smith, W. Hillier

Date :   29 Mar 14 (Deposition) - 20 Aug 14 (Release) - 10 Sep 14 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.39

Chains :   Asym. Unit : A
Biol. Unit 1: A  (2x)

Keywords :   Oxidoreductase, Ferritin, Electron Transfer (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Hingorani, R. Pace, S. Whitney, J. W. Murray, P. Smith, M. H. Cheah, T. Wydrzynski, W. Hillier
Photo-Oxidation Of Tyrosine In A Bio-Engineered Bacterioferritin 'Reaction Centre'-A Protein Model For Artificial Photosynthesis.
Biochim. Biophys. Acta V. 1837 1821 2014
PubMed-ID: 25107631 | Reference-DOI: 10.1016/J.BBABIO.2014.07.019

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 3)

Sites (3, 3)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (10, 10)

Asymmetric Unit (10, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_BFR_ECOLI_001 *	K	38	M	BFR_ECOLI	---	---	A	K	38	M
02	UniProt	VAR_BFR_ECOLI_002 *	R	57	K	BFR_ECOLI	---	---	A	R	57	K
03	UniProt	VAR_BFR_ECOLI_003 *	L	68	I	BFR_ECOLI	---	---	A	L	68	I
04	UniProt	VAR_BFR_ECOLI_004 *	N	78	G	BFR_ECOLI	---	---	A	N	78	G
05	UniProt	VAR_BFR_ECOLI_005 *	R	88	Q	BFR_ECOLI	---	---	A	R	88	Q
06	UniProt	VAR_BFR_ECOLI_006 *	A	92	R	BFR_ECOLI	---	---	A	A	92	R
07	UniProt	VAR_BFR_ECOLI_007 *	D	96	E	BFR_ECOLI	---	---	A	D	96	E
08	UniProt	VAR_BFR_ECOLI_008 *	N	100	D	BFR_ECOLI	---	---	A	N	100	D
09	UniProt	VAR_BFR_ECOLI_009 *	G	106	A	BFR_ECOLI	---	---	A	G	106	A
10	UniProt	VAR_BFR_ECOLI_010 *	R	125	A	BFR_ECOLI	---	---	A	R	125	A
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (10, 20)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_BFR_ECOLI_001 *	K	38	M	BFR_ECOLI	---	---	A	K	38	M
02	UniProt	VAR_BFR_ECOLI_002 *	R	57	K	BFR_ECOLI	---	---	A	R	57	K
03	UniProt	VAR_BFR_ECOLI_003 *	L	68	I	BFR_ECOLI	---	---	A	L	68	I
04	UniProt	VAR_BFR_ECOLI_004 *	N	78	G	BFR_ECOLI	---	---	A	N	78	G
05	UniProt	VAR_BFR_ECOLI_005 *	R	88	Q	BFR_ECOLI	---	---	A	R	88	Q
06	UniProt	VAR_BFR_ECOLI_006 *	A	92	R	BFR_ECOLI	---	---	A	A	92	R
07	UniProt	VAR_BFR_ECOLI_007 *	D	96	E	BFR_ECOLI	---	---	A	D	96	E
08	UniProt	VAR_BFR_ECOLI_008 *	N	100	D	BFR_ECOLI	---	---	A	N	100	D
09	UniProt	VAR_BFR_ECOLI_009 *	G	106	A	BFR_ECOLI	---	---	A	G	106	A
10	UniProt	VAR_BFR_ECOLI_010 *	R	125	A	BFR_ECOLI	---	---	A	R	125	A
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (2, 2)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:157
 aligned with BFR_ECOLI | P0ABD3 from UniProtKB/Swiss-Prot  Length:158

    Alignment length:157
                             1                                                                                                                                                           
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       
            BFR_ECOLI     - -MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIRE 156
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------M------------------K----------I---------G---------Q---R---E---D-----A------------------A------------------------------- SAPs(SNPs)
                PROSITE (1) -BACTERIOFERRITIN   ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) -FERRITIN_LIKE  PDB: A:1-145 UniProt: 1-145                                                                                                       ----------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cvs A   0 AMKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEFRESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVRDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIRE 156
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (14, 14)

Asymmetric Unit(hide GO term definitions)

Chain A (BFR_ECOLI | P0ABD3)

molecular function
	GO:0008199	ferric iron binding	Interacting selectively and non-covalently with ferric iron, Fe(III).
	GO:0004322	ferroxidase activity	Catalysis of the reaction: 4 Fe2+ + 4 H+ + O2 = 4 Fe3+ + 2 H2O.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0006879	cellular iron ion homeostasis	Any process involved in the maintenance of an internal steady state of iron ions at the level of a cell.
	GO:0006880	intracellular sequestering of iron ion	The process of binding or confining iron ions in an intracellular area such that they are separated from other components of a biological system.
	GO:0006826	iron ion transport	The directed movement of iron (Fe) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4cvs)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	4cvs
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BFR_ECOLI \| P0ABD3
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.16.3.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	BFR_ECOLI \| P0ABD3
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description