4BD7 - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:144
 aligned with BAX_HUMAN | Q07812 from UniProtKB/Swiss-Prot  Length:192

    Alignment length:157
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       
            BAX_HUMAN    14 TSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTW 170
               SCOP domains d4bd7a_ A: automated mat             ches                                                                                                                     SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhh.-------------..hhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.....hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------R----------------------------------------V-------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------------------------------------------BH3            -------------------------BH1  PDB: A:99-118  --------------------------------BH2         -------- PROSITE (1)
                PROSITE (2) -------------------------------------------------BCL2_FAMILY  PDB: A:63-160 UniProt: 63-160                                                        ---------- PROSITE (2)
           Transcript 1 (1) Exon 1.1f       ------------------------------------------------Exon 1.2c  PDB: A:78-123 UniProt: 78-123      Exon 1.4b  PDB: A:124-158          Exon 1.4m    Transcript 1 (1)
           Transcript 1 (2) ---------------Exon 1.1h  PDB: A:29-78 (gaps) UniProt: 29-78     -------------------------------------------------------------------------------------------- Transcript 1 (2)
                 4bd7 A  14 TSSEQIMKTGALLLQGFIQDRAGR-------------PQDASTKKLSESLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALSTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTW 170
                                    23        33   |     -       |53        63        73        83        93       103       113       123       133       143       153       163       
                                                  37            51

Chain B from PDB  Type:PROTEIN  Length:152
 aligned with BAX_HUMAN | Q07812 from UniProtKB/Swiss-Prot  Length:192

    Alignment length:157
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       
            BAX_HUMAN    14 TSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTW 170
               SCOP domains d4bd7b_ B: automated ma     tches                                                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh..-----...........hhhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------R----------------------------------------V-------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------------------------------------------BH3            -------------------------BH1  PDB: B:99-118  --------------------------------BH2         -------- PROSITE (1)
                PROSITE (2) -------------------------------------------------BCL2_FAMILY  PDB: B:63-160 UniProt: 63-160                                                        ---------- PROSITE (2)
           Transcript 1 (1) Exon 1.1f       ------------------------------------------------Exon 1.2c  PDB: B:78-123 UniProt: 78-123      Exon 1.4b  PDB: B:124-158          Exon 1.4m    Transcript 1 (1)
           Transcript 1 (2) ---------------Exon 1.1h  PDB: B:29-78 (gaps) UniProt: 29-78     -------------------------------------------------------------------------------------------- Transcript 1 (2)
                 4bd7 B  14 TSSEQIMKTGALLLQGFIQDRAG-----APELALDPVPQDASTKKLSESLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALSTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTW 170
                                    23        33  |     43        53        63        73        83        93       103       113       123       133       143       153       163       
                                                 36    42

Chain C from PDB  Type:PROTEIN  Length:132
 aligned with BAX_HUMAN | Q07812 from UniProtKB/Swiss-Prot  Length:192

    Alignment length:156
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164      
            BAX_HUMAN    15 SSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTW 170
               SCOP domains d4bd7c_ C: automated                    matches                                                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh-------------------hhhhhhhhhhhhhhhhhhhhhhhhh..-----.hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------R----------------------------------------V-------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------------------------------------BH3            -------------------------BH1  PDB: C:99-118  --------------------------------BH2         -------- PROSITE (1)
                PROSITE (2) ------------------------------------------------BCL2_FAMILY  PDB: C:63-160 UniProt: 63-160                                                        ---------- PROSITE (2)
           Transcript 1 (1) Exon 1.1f      ------------------------------------------------Exon 1.2c  PDB: C:78-123 (gaps)               Exon 1.4b  PDB: C:124-158          Exon 1.4m    Transcript 1 (1)
           Transcript 1 (2) --------------Exon 1.1h  PDB: C:29-78 (gaps) UniProt: 29-78     -------------------------------------------------------------------------------------------- Transcript 1 (2)
                 4bd7 C  15 SSEQIMKTGALLLQGFIQDRA-------------------STKKLSESLKRIGDELDSNMELQRMIA-----SPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALSTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTW 170
                                    24        34|        -         -|       64        74      |  -  |     94       104       114       124       134       144       154       164      
                                               35                  55                        81    87

Chain D from PDB  Type:PROTEIN  Length:132
 aligned with BAX_HUMAN | Q07812 from UniProtKB/Swiss-Prot  Length:192

    Alignment length:155
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165     
            BAX_HUMAN    16 SEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTW 170
               SCOP domains d4bd7d_ D: automated                   matches                                                                                                              SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh------------------..hhhhhhhhhhhhh...hhhhhhhhh.-----hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------R----------------------------------------V-------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------------------------------------------BH3            -------------------------BH1  PDB: D:99-118  --------------------------------BH2         -------- PROSITE (1)
                PROSITE (2) -----------------------------------------------BCL2_FAMILY  PDB: D:63-160 UniProt: 63-160                                                        ---------- PROSITE (2)
           Transcript 1 (1) Exon 1.1f     ------------------------------------------------Exon 1.2c  PDB: D:78-123 (gaps)               Exon 1.4b  PDB: D:124-158          Exon 1.4m    Transcript 1 (1)
           Transcript 1 (2) -------------Exon 1.1h  PDB: D:29-78 (gaps) UniProt: 29-78     -------------------------------------------------------------------------------------------- Transcript 1 (2)
                 4bd7 D  16 SEQIMKTGALLLQGFIQDRAG------------------STKKLSESLKRIGDELDSNMELQRMIAA-----PREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALSTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTW 170
                                    25        35|        -        55        65        75      |  -  |     95       105       115       125       135       145       155       165     
                                               36                 55                         82    88

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (BAX_HUMAN | Q07812)

molecular function
	GO:0051400	BH domain binding	Interacting selectively and non-covalently with the Bcl-2 homology (BH) domain of a protein. Bcl-2-related proteins share homology in one to four conserved regions designated the Bcl-2 homology (BH) domains BH1, BH2, BH3 and BH4. These domains contribute at multiple levels to the function of these proteins in cell death and survival. Anti-apoptotic members of the Bcl-2 family have four BH domains (BH1-BH4). Pro-apoptotic members have fewer BH domains.
	GO:0051434	BH3 domain binding	Interacting selectively and non-covalently with the BH3 domain of a protein of the Bcl-2 family. The BH3 domain is a potent death domain and has an important role in protein-protein interactions and in cell death.
	GO:0015267	channel activity	Enables the energy-independent facilitated diffusion, mediated by passage of a solute through a transmembrane aqueous pore or channel. Stereospecificity is not exhibited but this transport may be specific for a particular molecular species or class of molecules.
	GO:0051087	chaperone binding	Interacting selectively and non-covalently with a chaperone protein, a class of proteins that bind to nascent or unfolded polypeptides and ensure correct folding or transport.
	GO:0031072	heat shock protein binding	Interacting selectively and non-covalently with a heat shock protein, any protein synthesized or activated in response to heat shock.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046982	protein heterodimerization activity	Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
	GO:0001783	B cell apoptotic process	Any apoptotic process in a B cell, a lymphocyte of B lineage with the phenotype CD19-positive and capable of B cell mediated immunity.
	GO:0001782	B cell homeostasis	The process of regulating the proliferation and elimination of B cells such that the total number of B cells within a whole or part of an organism is stable over time in the absence of an outside stimulus.
	GO:0002358	B cell homeostatic proliferation	The non-specific expansion of B cell populations within a whole or part of an organism to reach to a total number of B cells which will then remain stable over time in the absence of an external stimulus.
	GO:0002352	B cell negative selection	Any process leading to negative selection in B cells. Mechanisms of negative selection include anergy and deletion.
	GO:1990117	B cell receptor apoptotic signaling pathway	An extrinsic apoptotic signaling pathway initiated by the cross-linking of an antigen receptor on a B cell.
	GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage and resulting in the stopping or reduction in rate of the cell cycle.
	GO:0060011	Sertoli cell proliferation	The multiplication or reproduction of Sertoli cells, resulting in the expansion of the Sertoli cell population. A Sertoli cell is a supporting cell projecting inward from the basement membrane of seminiferous tubules.
	GO:0001777	T cell homeostatic proliferation	The non-specific expansion of T cell populations within a whole or part of an organism to reach to a total number of T cells which will then remain stable over time in the absence of an external stimulus.
	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase in the context of an apoptotic process.
	GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase in the context of an apoptotic process and is mediated by cytochrome c.
	GO:0097296	activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	Any process that initiates the activity of an inactive cysteine-type endopeptidase involved in the apoptotic signaling pathway.
	GO:0006987	activation of signaling protein activity involved in unfolded protein response	The conversion of a specific protein, possessing protein kinase and endoribonuclease activities, to an active form as a result of signaling via the unfolded protein response.
	GO:0007568	aging	A developmental process that is a deterioration and loss of function over time. Aging includes loss of functions such as resistance to disease, homeostasis, and fertility, as well as wear and tear. Aging includes cellular senescence, but is more inclusive. May precede death and may succeed developmental maturation (GO:0021700).
	GO:0008637	apoptotic mitochondrial changes	The morphological and physiological alterations undergone by mitochondria during apoptosis.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:1902262	apoptotic process involved in blood vessel morphogenesis	Any apoptotic process that is involved in blood vessel morphogenesis.
	GO:1902263	apoptotic process involved in embryonic digit morphogenesis	Any apoptotic process that is involved in embryonic digit morphogenesis.
	GO:0097190	apoptotic signaling pathway	A series of molecular signals which triggers the apoptotic death of a cell. The pathway starts with reception of a signal, and ends when the execution phase of apoptosis is triggered.
	GO:0001974	blood vessel remodeling	The reorganization or renovation of existing blood vessels.
	GO:0007420	brain development	The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.).
	GO:0008283	cell proliferation	The multiplication or reproduction of cells, resulting in the expansion of a cell population.
	GO:0045333	cellular respiration	The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which either requires oxygen (aerobic respiration) or does not (anaerobic respiration).
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0034644	cellular response to UV	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ultraviolet radiation (UV light) stimulus. Ultraviolet radiation is electromagnetic radiation with a wavelength in the range of 10 to 380 nanometers.
	GO:0071310	cellular response to organic substance	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
	GO:0021987	cerebral cortex development	The progression of the cerebral cortex over time from its initial formation until its mature state. The cerebral cortex is the outer layered region of the telencephalon.
	GO:0045136	development of secondary sexual characteristics	The process whose specific outcome is the progression of the secondary sexual characteristics over time, from their formation to the mature structures. In humans, these include growth of axillary, chest, and pubic hair, voice changes, testicular/penile enlargement, breast development and menstrual periods. Development occurs in response to sex hormone secretion.
	GO:0035234	ectopic germ cell programmed cell death	Programmed cell death of an errant germ line cell that is outside the normal migratory path or ectopic to the gonad. This is an important mechanism of regulating germ cell survival within the embryo.
	GO:0032469	endoplasmic reticulum calcium ion homeostasis	Any process involved in the maintenance of an internal steady state of calcium ions within the endoplasmic reticulum of a cell or between the endoplasmic reticulum and its surroundings.
	GO:0010248	establishment or maintenance of transmembrane electrochemical gradient	The directed movement of ions to establish or maintain an electrochemical gradient across a membrane by means of some agent such as a transporter or pore.
	GO:0097191	extrinsic apoptotic signaling pathway	A series of molecular signals in which a signal is conveyed from the cell surface to trigger the apoptotic death of a cell. The pathway starts with either a ligand binding to a cell surface receptor, or a ligand being withdrawn from a cell surface receptor (e.g. in the case of signaling by dependence receptors), and ends when the execution phase of apoptosis is triggered.
	GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	A series of molecular signals in which a signal is conveyed from the cell surface to trigger the apoptotic death of a cell. The pathway starts with withdrawal of a ligand from a cell surface receptor, and ends when the execution phase of apoptosis is triggered.
	GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	A series of molecular signals in which a signal is conveyed from the cell surface to trigger the apoptotic death of a cell. The pathway starts with a ligand binding to a death domain receptor on the cell surface, and ends when the execution phase of apoptosis is triggered.
	GO:0009566	fertilization	The union of gametes of opposite sexes during the process of sexual reproduction to form a zygote. It involves the fusion of the gametic nuclei (karyogamy) and cytoplasm (plasmogamy).
	GO:0007281	germ cell development	The process whose specific outcome is the progression of an immature germ cell over time, from its formation to the mature structure (gamete). A germ cell is any reproductive cell in a multicellular organism.
	GO:0034349	glial cell apoptotic process	Any apoptotic process in a glial cell, a non-neuronal cell of the nervous system.
	GO:0006687	glycosphingolipid metabolic process	The chemical reactions and pathways involving glycosphingolipids, any compound with residues of sphingoid and at least one monosaccharide.
	GO:0048872	homeostasis of number of cells	Any biological process involved in the maintenance of the steady-state number of cells within a population of cells.
	GO:0048873	homeostasis of number of cells within a tissue	Any biological process involved in the maintenance of the steady-state number of cells within a population of cells in a tissue.
	GO:0021854	hypothalamus development	The progression of the hypothalamus region of the forebrain, from its initial formation to its mature state.
	GO:0007007	inner mitochondrial membrane organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the mitochondrial inner membrane.
	GO:0097193	intrinsic apoptotic signaling pathway	A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway starts with reception of an intracellular signal (e.g. DNA damage, endoplasmic reticulum stress, oxidative stress etc.), and ends when the execution phase of apoptosis is triggered. The intrinsic apoptotic signaling pathway is crucially regulated by permeabilization of the mitochondrial outer membrane (MOMP).
	GO:0072332	intrinsic apoptotic signaling pathway by p53 class mediator	A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, and ends when the execution phase of apoptosis is triggered.
	GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
	GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced in response to a stimulus indicating endoplasmic reticulum (ER) stress, and ends when the execution phase of apoptosis is triggered. ER stress usually results from the accumulation of unfolded or misfolded proteins in the ER lumen.
	GO:0001822	kidney development	The process whose specific outcome is the progression of the kidney over time, from its formation to the mature structure. The kidney is an organ that filters the blood and/or excretes the end products of body metabolism in the form of urine.
	GO:0001776	leukocyte homeostasis	The process of regulating the proliferation and elimination of cells of the immune system such that the total number of cells of a particular cell type within a whole or part of an organism is stable over time in the absence of an outside stimulus.
	GO:0035108	limb morphogenesis	The process in which the anatomical structures of a limb are generated and organized. A limb is a paired appendage of a tetrapod used for locomotion or grasping.
	GO:0008584	male gonad development	The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
	GO:0043653	mitochondrial fragmentation involved in apoptotic process	The change in the morphology of the mitochondria in an apoptotic cell from a highly branched network to a fragmented vesicular form.
	GO:0008053	mitochondrial fusion	Merging of two or more mitochondria within a cell to form a single compartment.
	GO:0070584	mitochondrion morphogenesis	The process in which the anatomical structures of a mitochondrion are generated and organized.
	GO:0002262	myeloid cell homeostasis	The process of regulating the proliferation and elimination of myeloid cells such that the total number of myeloid cells within a whole or part of an organism is stable over time in the absence of an outside stimulus.
	GO:2001234	negative regulation of apoptotic signaling pathway	Any process that stops, prevents or reduces the frequency, rate or extent of apoptotic signaling pathway.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0032471	negative regulation of endoplasmic reticulum calcium ion concentration	Any process that decreases the concentration of calcium ions in the endoplasmic reticulum.
	GO:0048147	negative regulation of fibroblast proliferation	Any process that stops, prevents, or reduces the frequency, rate or extent of multiplication or reproduction of fibroblast cells.
	GO:0043524	negative regulation of neuron apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process in neurons.
	GO:0033137	negative regulation of peptidyl-serine phosphorylation	Any process that stops, prevents, or reduces the frequency, rate or extent of the phosphorylation of peptidyl-serine.
	GO:0032091	negative regulation of protein binding	Any process that stops, prevents, or reduces the frequency, rate or extent of protein binding.
	GO:0007399	nervous system development	The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
	GO:0051402	neuron apoptotic process	Any apoptotic process in a neuron, the basic cellular unit of nervous tissue. Each neuron consists of a body, an axon, and dendrites. Their purpose is to receive, conduct, and transmit impulses in the nervous system.
	GO:0001764	neuron migration	The characteristic movement of an immature neuron from germinal zones to specific positions where they will reside as they mature.
	GO:0006927	obsolete transformed cell apoptotic process	OBSOLETE. Any apoptotic process in a transformed cell, a cell that has undergone changes manifested by escape from control mechanisms, increased growth potential, alterations in the cell surface, karyotypic abnormalities, morphological and biochemical deviations from the norm.
	GO:0042475	odontogenesis of dentin-containing tooth	The process whose specific outcome is the progression of a dentin-containing tooth over time, from its formation to the mature structure. A dentin-containing tooth is a hard, bony organ borne on the jaw or other bone of a vertebrate, and is composed mainly of dentin, a dense calcified substance, covered by a layer of enamel.
	GO:0007008	outer mitochondrial membrane organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the mitochondrial outer membrane.
	GO:0001541	ovarian follicle development	The process whose specific outcome is the progression of the ovarian follicle over time, from its formation to the mature structure.
	GO:0002904	positive regulation of B cell apoptotic process	Any process that activates or increases the frequency, rate, or extent of B cell apoptotic process.
	GO:1903896	positive regulation of IRE1-mediated unfolded protein response	Any process that activates or increases the frequency, rate or extent of the IRE1-mediated unfolded protein response.
	GO:1902512	positive regulation of apoptotic DNA fragmentation	Any process that activates or increases the frequency, rate or extent of apoptotic DNA fragmentation.
	GO:0043065	positive regulation of apoptotic process	Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
	GO:0060058	positive regulation of apoptotic process involved in mammary gland involution	Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process of mammary epithelial cells during mammary gland involution.
	GO:0010524	positive regulation of calcium ion transport into cytosol	Any process that increases the rate of the directed movement of calcium ions into the cytosol of a cell. The cytosol is that part of the cytoplasm that does not contain membranous or particulate subcellular components.
	GO:0048087	positive regulation of developmental pigmentation	Any process that increases the frequency, rate or extent of the developmental process that results in the deposition of coloring matter in an organism.
	GO:1900103	positive regulation of endoplasmic reticulum unfolded protein response	Any process that activates or increases the frequency, rate or extent of endoplasmic reticulum unfolded protein response.
	GO:2001241	positive regulation of extrinsic apoptotic signaling pathway in absence of ligand	Any process that activates or increases the frequency, rate or extent of extrinsic apoptotic signaling pathway in absence of ligand.
	GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	Any process that activates or increases the frequency, rate or extent of intrinsic apoptotic signaling pathway.
	GO:1902110	positive regulation of mitochondrial membrane permeability involved in apoptotic process	Any positive regulation of mitochondrial membrane permeability that is involved in apoptotic process.
	GO:1901030	positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	Any process that activates or increases the frequency, rate or extent of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway.
	GO:0043525	positive regulation of neuron apoptotic process	Any process that activates or increases the frequency, rate or extent of cell death of neurons by apoptotic process.
	GO:0032461	positive regulation of protein oligomerization	Any process that activates or increases the frequency, rate or extent of protein oligomerization.
	GO:0090200	positive regulation of release of cytochrome c from mitochondria	Any process that increases the rate, frequency or extent of release of cytochrome c from mitochondria, the process in which cytochrome c is enabled to move from the mitochondrial intermembrane space into the cytosol, which is an early step in apoptosis and leads to caspase activation.
	GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	Any process that activates or increases the frequency, rate or extent of the release into the cytosolic compartment of calcium ions sequestered in the endoplasmic reticulum or mitochondria.
	GO:0048597	post-embryonic camera-type eye morphogenesis	The process in which the anatomical structures of the eye are generated and organized during post-embryonic development.
	GO:0009791	post-embryonic development	The process whose specific outcome is the progression of the organism over time, from the completion of embryonic development to the mature structure. See embryonic development.
	GO:0051260	protein homooligomerization	The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of identical component monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
	GO:0001844	protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	The process in which a protein is incorporated into a mitochondrial membrane as the initial phase of the mitochondrial membrane permeabilization that takes place in the apoptotic signaling pathway.
	GO:0051259	protein oligomerization	The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers; protein oligomers may be composed of different or identical monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
	GO:0042981	regulation of apoptotic process	Any process that modulates the occurrence or rate of cell death by apoptotic process.
	GO:0051726	regulation of cell cycle	Any process that modulates the rate or extent of progression through the cell cycle.
	GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that modulates the activity of a cysteine-type endopeptidase involved in apoptosis.
	GO:0033599	regulation of mammary gland epithelial cell proliferation	Any process that modulates the frequency, rate or extent of mammary gland epithelial cell proliferation.
	GO:1902108	regulation of mitochondrial membrane permeability involved in apoptotic process	Any regulation of mitochondrial membrane permeability that is involved in apoptotic process.
	GO:1902445	regulation of mitochondrial membrane permeability involved in programmed necrotic cell death	Any regulation of mitochondrial membrane permeability that is involved in programmed necrotic cell death.
	GO:0051881	regulation of mitochondrial membrane potential	Any process that modulates the establishment or extent of the mitochondrial membrane potential, the electric potential existing across the mitochondrial membrane arising from charges in the membrane itself and from the charges present in the media on either side of the membrane.
	GO:0043523	regulation of neuron apoptotic process	Any process that modulates the occurrence or rate of cell death by apoptotic process in neurons.
	GO:0006808	regulation of nitrogen utilization	Any process that modulates the frequency, rate or extent of nitrogen utilization.
	GO:0043497	regulation of protein heterodimerization activity	Any process that modulates the frequency, rate or extent of protein heterodimerization, interacting selectively with a nonidentical protein to form a heterodimer.
	GO:0043496	regulation of protein homodimerization activity	Any process that modulates the frequency, rate or extent of protein homodimerization, interacting selectively with an identical protein to form a homodimer.
	GO:0001836	release of cytochrome c from mitochondria	The process that results in the movement of cytochrome c from the mitochondrial intermembrane space into the cytosol, which is part of the apoptotic signaling pathway and leads to caspase activation.
	GO:0032976	release of matrix enzymes from mitochondria	The process in which enzymes, such as aspartate aminotransferase, are enabled to move from the mitochondrial matrix into the cytosol, as part of the apoptotic process.
	GO:0048678	response to axon injury	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an axon injury stimulus.
	GO:0042220	response to cocaine	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cocaine stimulus. Cocaine is a crystalline alkaloid obtained from the leaves of the coca plant.
	GO:0046688	response to copper ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a copper ion stimulus.
	GO:0051412	response to corticosterone	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a corticosterone stimulus. Corticosterone is a 21 carbon steroid hormone of the corticosteroid type, produced in the cortex of the adrenal glands. In many species, corticosterone is the principal glucocorticoid, involved in regulation of fuel metabolism, immune reactions, and stress responses.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0010332	response to gamma radiation	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a gamma radiation stimulus. Gamma radiation is a form of electromagnetic radiation (EMR) or light emission of a specific frequency produced from sub-atomic particle interaction, such as electron-positron annihilation and radioactive decay. Gamma rays are generally characterized as EMR having the highest frequency and energy, and also the shortest wavelength, within the electromagnetic radiation spectrum.
	GO:0010212	response to ionizing radiation	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a ionizing radiation stimulus. Ionizing radiation is radiation with sufficient energy to remove electrons from atoms and may arise from spontaneous decay of unstable isotopes, resulting in alpha and beta particles and gamma rays. Ionizing radiation also includes X-rays.
	GO:0009651	response to salt stress	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating an increase or decrease in the concentration of salt (particularly but not exclusively sodium and chloride ions) in the environment.
	GO:0009636	response to toxic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a toxic stimulus.
	GO:0009611	response to wounding	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to the organism.
	GO:0060041	retina development in camera-type eye	The process whose specific outcome is the progression of the retina over time, from its formation to the mature structure. The retina is the innermost layer or coating at the back of the eyeball, which is sensitive to light and in which the optic nerve terminates.
	GO:0046666	retinal cell programmed cell death	Programmed cell death that occurs in the developing retina.
	GO:0007548	sex differentiation	The establishment of the sex of an organism by physical differentiation.
	GO:0048515	spermatid differentiation	The process whose specific outcome is the progression of a spermatid over time, from initial commitment of the cell to a specific fate, to the fully functional differentiated cell.
	GO:0007283	spermatogenesis	The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
	GO:0070242	thymocyte apoptotic process	Any apoptotic process in a thymocyte, an immature T cell located in the thymus.
	GO:0060068	vagina development	The reproductive developmental process whose specific outcome is the progression of the vagina over time, from its formation to the mature structure.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0097144	BAX complex	An oligomeric protein complex consisting of BAX, a member of the Bcl-2 family of anti- and proapoptotic regulators.
	GO:0097136	Bcl-2 family protein complex	A protein complex that consists of members of the Bcl-2 family of anti- and proapoptotic regulators. Bcl-2 proteins respond to cues from various forms of intracellular stress, such as DNA damage or cytokine deprivation, and interact with opposing family members to determine whether or not the caspase proteolytic cascade should be unleashed.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0031966	mitochondrial membrane	Either of the lipid bilayers that surround the mitochondrion and form the mitochondrial envelope.
	GO:0005741	mitochondrial outer membrane	The outer, i.e. cytoplasm-facing, lipid bilayer of the mitochondrial envelope.
	GO:0005757	mitochondrial permeability transition pore complex	A protein complex that connects the inner and outer membranes of animal mitochondria and acts as a pore that can open transiently to allow free diffusion of solutes between the mitochondrial matrix and the cytosol. The pore complex is formed of the voltage-dependent anion channel (VDAC), the adenine nucleotide translocase (ANT) and cyclophilin-D (CyP-D).
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005635	nuclear envelope	The double lipid bilayer enclosing the nucleus and separating its contents from the rest of the cytoplasm; includes the intermembrane space, a gap of width 20-40 nm (also called the perinuclear space).
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0046930	pore complex	Any small opening in a membrane that allows the passage of gases and/or liquids.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 3)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 8)

PROSITE Motifs (4, 16)

Exons (5, 20)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (148, 148)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File