3UA5 - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF P450 2B6 (Y226H/K262R) IN COMPLEX WITH TWO MOLECULES OF AMLODIPINE

Authors :   M. B. Shah, C. D. Stout, J. R. Halpert

Date :   21 Oct 11 (Deposition) - 12 Sep 12 (Release) - 03 Oct 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.80

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: A (1x),B (1x)

Keywords :   P450, Human Cytochrome P450 2B6, Monooxygenase, Oxidoreductase, Membrane Protein, Cyp 2B6 (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. B. Shah, P. R. Wilderman, J. Pascual, Q. Zhang, C. D. Stout, J. R. Halpert
Conformational Adaptation Of Human Cytochrome P450 2B6 And Rabbit Cytochrome P450 2B4 Revealed Upon Binding Multiple Amlodipine Molecules.
Biochemistry V. 51 7225 2012
PubMed-ID: 22909231 | Reference-DOI: 10.1021/BI300894Z

Molecule 1 - CYTOCHROME P450 2B6
	Chains	:	A, B
	EC Number	:	1.14.14.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PKK
	Expression System Strain	:	JM109
	Expression System Taxid	:	83333
	Expression System Vector Type	:	PLASMID
	Gene	:	CYP2B6
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CYPIIB6, CYTOCHROME P450 IIB1

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:	A (1x)	B (1x)

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 6)

No.	Name	Count	Type	Full Name
1	06X	4	Ligand/Ion	AMLODIPINE
2	HEM	2	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE

Biological Unit 1 (2, 3)

No.	Name	Count	Type	Full Name
1	06X	2	Ligand/Ion	AMLODIPINE
2	HEM	1	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE

Biological Unit 2 (2, 3)

No.	Name	Count	Type	Full Name
1	06X	2	Ligand/Ion	AMLODIPINE
2	HEM	1	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE

Biological Unit 3 (2, 3)

No.	Name	Count	Type	Full Name
1	06X	2	Ligand/Ion	AMLODIPINE
2	HEM	1	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ARG A:98 , VAL A:113 , TRP A:121 , ARG A:125 , ALA A:298 , GLY A:299 , THR A:302 , HIS A:369 , PRO A:428 , PHE A:429 , SER A:430 , ARG A:434 , CYS A:436 , LEU A:437 , GLY A:438 , 06X A:501	BINDING SITE FOR RESIDUE HEM A 500
2	AC2	SOFTWARE	ILE A:101 , PHE A:115 , ALA A:298 , THR A:300 , THR A:302 , VAL A:477 , HEM A:500	BINDING SITE FOR RESIDUE 06X A 501
3	AC3	SOFTWARE	ARG A:49 , LEU A:51 , ARG A:73 , GLN A:215 , GLU A:218 , LEU A:219 , MET A:365 , PHE A:389 , GLY A:476 , VAL A:477	BINDING SITE FOR RESIDUE 06X A 502
4	AC4	SOFTWARE	ARG B:98 , VAL B:113 , TRP B:121 , ARG B:125 , THR B:302 , THR B:306 , LEU B:362 , HIS B:369 , PRO B:428 , PHE B:429 , SER B:430 , ARG B:434 , CYS B:436 , LEU B:437 , GLY B:438 , 06X B:501	BINDING SITE FOR RESIDUE HEM B 500
5	AC5	SOFTWARE	ILE B:101 , PHE B:115 , PHE B:206 , SER B:210 , PHE B:297 , ALA B:298 , THR B:300 , GLU B:301 , THR B:302 , VAL B:477 , HEM B:500	BINDING SITE FOR RESIDUE 06X B 501
6	AC6	SOFTWARE	LEU B:51 , ARG B:73 , GLN B:215 , GLU B:218 , LEU B:219 , PRO B:368 , PHE B:389 , GLY B:476 , VAL B:477	BINDING SITE FOR RESIDUE 06X B 502

(no "SS Bond" information available for 3UA5)

Asymmetric Unit

No.	Residues
1	Arg A:48	-	Arg A:49
2	Arg B:48	-	Arg B:49

Asymmetric Unit (16, 31)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_025207	D	28	G	CP2B6_HUMAN	Polymorphism	33980385	A	G	28	G
02	UniProt	VAR_033819	R	29	P	CP2B6_HUMAN	Polymorphism	34284776	A/B	K	29	P
03	UniProt	VAR_025208	R	29	S	CP2B6_HUMAN	Polymorphism	33926104	A/B	K	29	S
04	UniProt	VAR_023564	M	46	V	CP2B6_HUMAN	Polymorphism	35303484	A/B	M	46	V
05	UniProt	VAR_023565	G	99	E	CP2B6_HUMAN	Polymorphism	36060847	A/B	G	99	E
06	UniProt	VAR_016948	K	139	E	CP2B6_HUMAN	Polymorphism	12721655	A/B	K	139	E
07	UniProt	VAR_023566	R	140	Q	CP2B6_HUMAN	Polymorphism	35773040	A/B	R	140	Q
08	UniProt	VAR_016924	P	167	A	CP2B6_HUMAN	Polymorphism	3826711	A/B	P	167	A
09	UniProt	VAR_016925	Q	172	H	CP2B6_HUMAN	Polymorphism	3745274	A/B	Q	172	H
10	UniProt	VAR_016928	S	259	R	CP2B6_HUMAN	Polymorphism	45482602	A/B	S	259	R
11	UniProt	VAR_016926	K	262	R	CP2B6_HUMAN	Polymorphism	2279343	A/B	R	262	R
12	UniProt	VAR_025209	N	289	K	CP2B6_HUMAN	Polymorphism	34277950	A/B	N	289	K
13	UniProt	VAR_025210	T	306	S	CP2B6_HUMAN	Polymorphism	34698757	A/B	T	306	S
14	UniProt	VAR_024716	I	328	T	CP2B6_HUMAN	Polymorphism	28399499	A/B	I	328	T
15	UniProt	VAR_023567	I	391	N	CP2B6_HUMAN	Polymorphism	35979566	A/B	I	391	N
16	UniProt	VAR_016929	R	487	C	CP2B6_HUMAN	Polymorphism	3211371	A/B	R	487	C

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (16, 16)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_025207	D	28	G	CP2B6_HUMAN	Polymorphism	33980385	A	G	28	G
02	UniProt	VAR_033819	R	29	P	CP2B6_HUMAN	Polymorphism	34284776	A	K	29	P
03	UniProt	VAR_025208	R	29	S	CP2B6_HUMAN	Polymorphism	33926104	A	K	29	S
04	UniProt	VAR_023564	M	46	V	CP2B6_HUMAN	Polymorphism	35303484	A	M	46	V
05	UniProt	VAR_023565	G	99	E	CP2B6_HUMAN	Polymorphism	36060847	A	G	99	E
06	UniProt	VAR_016948	K	139	E	CP2B6_HUMAN	Polymorphism	12721655	A	K	139	E
07	UniProt	VAR_023566	R	140	Q	CP2B6_HUMAN	Polymorphism	35773040	A	R	140	Q
08	UniProt	VAR_016924	P	167	A	CP2B6_HUMAN	Polymorphism	3826711	A	P	167	A
09	UniProt	VAR_016925	Q	172	H	CP2B6_HUMAN	Polymorphism	3745274	A	Q	172	H
10	UniProt	VAR_016928	S	259	R	CP2B6_HUMAN	Polymorphism	45482602	A	S	259	R
11	UniProt	VAR_016926	K	262	R	CP2B6_HUMAN	Polymorphism	2279343	A	R	262	R
12	UniProt	VAR_025209	N	289	K	CP2B6_HUMAN	Polymorphism	34277950	A	N	289	K
13	UniProt	VAR_025210	T	306	S	CP2B6_HUMAN	Polymorphism	34698757	A	T	306	S
14	UniProt	VAR_024716	I	328	T	CP2B6_HUMAN	Polymorphism	28399499	A	I	328	T
15	UniProt	VAR_023567	I	391	N	CP2B6_HUMAN	Polymorphism	35979566	A	I	391	N
16	UniProt	VAR_016929	R	487	C	CP2B6_HUMAN	Polymorphism	3211371	A	R	487	C

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (15, 15)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
02	UniProt	VAR_033819	R	29	P	CP2B6_HUMAN	Polymorphism	34284776	B	K	29	P
03	UniProt	VAR_025208	R	29	S	CP2B6_HUMAN	Polymorphism	33926104	B	K	29	S
04	UniProt	VAR_023564	M	46	V	CP2B6_HUMAN	Polymorphism	35303484	B	M	46	V
05	UniProt	VAR_023565	G	99	E	CP2B6_HUMAN	Polymorphism	36060847	B	G	99	E
06	UniProt	VAR_016948	K	139	E	CP2B6_HUMAN	Polymorphism	12721655	B	K	139	E
07	UniProt	VAR_023566	R	140	Q	CP2B6_HUMAN	Polymorphism	35773040	B	R	140	Q
08	UniProt	VAR_016924	P	167	A	CP2B6_HUMAN	Polymorphism	3826711	B	P	167	A
09	UniProt	VAR_016925	Q	172	H	CP2B6_HUMAN	Polymorphism	3745274	B	Q	172	H
10	UniProt	VAR_016928	S	259	R	CP2B6_HUMAN	Polymorphism	45482602	B	S	259	R
11	UniProt	VAR_016926	K	262	R	CP2B6_HUMAN	Polymorphism	2279343	B	R	262	R
12	UniProt	VAR_025209	N	289	K	CP2B6_HUMAN	Polymorphism	34277950	B	N	289	K
13	UniProt	VAR_025210	T	306	S	CP2B6_HUMAN	Polymorphism	34698757	B	T	306	S
14	UniProt	VAR_024716	I	328	T	CP2B6_HUMAN	Polymorphism	28399499	B	I	328	T
15	UniProt	VAR_023567	I	391	N	CP2B6_HUMAN	Polymorphism	35979566	B	I	391	N
16	UniProt	VAR_016929	R	487	C	CP2B6_HUMAN	Polymorphism	3211371	B	R	487	C

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (16, 31)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_025207	D	28	G	CP2B6_HUMAN	Polymorphism	33980385	A	G	28	G
02	UniProt	VAR_033819	R	29	P	CP2B6_HUMAN	Polymorphism	34284776	A/B	K	29	P
03	UniProt	VAR_025208	R	29	S	CP2B6_HUMAN	Polymorphism	33926104	A/B	K	29	S
04	UniProt	VAR_023564	M	46	V	CP2B6_HUMAN	Polymorphism	35303484	A/B	M	46	V
05	UniProt	VAR_023565	G	99	E	CP2B6_HUMAN	Polymorphism	36060847	A/B	G	99	E
06	UniProt	VAR_016948	K	139	E	CP2B6_HUMAN	Polymorphism	12721655	A/B	K	139	E
07	UniProt	VAR_023566	R	140	Q	CP2B6_HUMAN	Polymorphism	35773040	A/B	R	140	Q
08	UniProt	VAR_016924	P	167	A	CP2B6_HUMAN	Polymorphism	3826711	A/B	P	167	A
09	UniProt	VAR_016925	Q	172	H	CP2B6_HUMAN	Polymorphism	3745274	A/B	Q	172	H
10	UniProt	VAR_016928	S	259	R	CP2B6_HUMAN	Polymorphism	45482602	A/B	S	259	R
11	UniProt	VAR_016926	K	262	R	CP2B6_HUMAN	Polymorphism	2279343	A/B	R	262	R
12	UniProt	VAR_025209	N	289	K	CP2B6_HUMAN	Polymorphism	34277950	A/B	N	289	K
13	UniProt	VAR_025210	T	306	S	CP2B6_HUMAN	Polymorphism	34698757	A/B	T	306	S
14	UniProt	VAR_024716	I	328	T	CP2B6_HUMAN	Polymorphism	28399499	A/B	I	328	T
15	UniProt	VAR_023567	I	391	N	CP2B6_HUMAN	Polymorphism	35979566	A/B	I	391	N
16	UniProt	VAR_016929	R	487	C	CP2B6_HUMAN	Polymorphism	3211371	A/B	R	487	C

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CYTOCHROME_P450	PS00086	Cytochrome P450 cysteine heme-iron ligand signature.	CP2B6_HUMAN	429-438	2	A:429-438 B:429-438

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CYTOCHROME_P450	PS00086	Cytochrome P450 cysteine heme-iron ligand signature.	CP2B6_HUMAN	429-438	1	A:429-438 -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CYTOCHROME_P450	PS00086	Cytochrome P450 cysteine heme-iron ligand signature.	CP2B6_HUMAN	429-438	1	- B:429-438

Biological Unit 3 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CYTOCHROME_P450	PS00086	Cytochrome P450 cysteine heme-iron ligand signature.	CP2B6_HUMAN	429-438	2	A:429-438 B:429-438

(no "Exon" information available for 3UA5)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:465
 aligned with CP2B6_HUMAN | P20813 from UniProtKB/Swiss-Prot  Length:491

    Alignment length:465
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         491 
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487   | 
          CP2B6_HUMAN    28 DRLPPGPRPLPLLGNLLQMDRRGLLKSFLRFREKYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNRWKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFHYQDQEFLKMLNLFYQTFSLISSVFGQLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDLIDTYLLHMEKEKSNAHSEFSHQNLNLNTLSLFFAGTETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFSDLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGALKKTEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKIPPTYQIRFLPR-   -
               SCOP domains d3ua5a_ A: automated matches                                                                                                                                                                                                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......................hhhhhhhhhhhhhh.eeeeee..eeeeeehhhhhhhhhhh.hhhhhh.......hhhhhh.......hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhh.........hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh.......ee....ee....ee....eeeehhhhhhh...........hhhhhh.......................hhhhhhhhhhhhhhhhhhhheee...hhhhh..................eee... Sec.struct. author
             SAPs(SNPs) (1) GP----------------V----------------------------------------------------E---------------------------------------EQ--------------------------A----H--------------------------------------------------------------------------------------R--R--------------------------K----------------S---------------------T--------------------------------------------------------------N-----------------------------------------------------------------------------------------------C----- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -S------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CYTOCHROME------------------------------------------------------ PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ua5 A  28 GKLPPGPRPLPLLGNLLQMDRRGLLKSFLRFREKYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNRWKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFHYQDQEFLKMLNLFYQTFSLISSVFGQLFELFSGFLKHFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPRDLIDTYLLHMEKEKSNAHSEFSHQNLNLNTLSLFFAGTETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFSDLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGALKKTEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKIPPTYQIRFLPRH 492
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487

Chain B from PDB  Type:PROTEIN  Length:462
 aligned with CP2B6_HUMAN | P20813 from UniProtKB/Swiss-Prot  Length:491

    Alignment length:464
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        491 
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488  | 
          CP2B6_HUMAN    29 RLPPGPRPLPLLGNLLQMDRRGLLKSFLRFREKYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNRWKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFHYQDQEFLKMLNLFYQTFSLISSVFGQLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDLIDTYLLHMEKEKSNAHSEFSHQNLNLNTLSLFFAGTETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFSDLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGALKKTEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKIPPTYQIRFLPR-   -
               SCOP domains d3ua5b_ B: automated matches                                                                                                                                                                                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhh...hhhhhhhhhhhhhh.eeeeee..eeeeeehhhhhhhhhhh.hhhhhh.......hhhhhh.......hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhh..--.....hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh.......ee....ee....ee....eeee.hhhhhh...........hhhhhh.......................hhhhhhhhhhhhhhhhhhhheee...hhhhh..................eee... Sec.struct. author
             SAPs(SNPs) (1) P----------------V----------------------------------------------------E---------------------------------------EQ--------------------------A----H--------------------------------------------------------------------------------------R--R--------------------------K----------------S---------------------T--------------------------------------------------------------N-----------------------------------------------------------------------------------------------C----- SAPs(SNPs) (1)
             SAPs(SNPs) (2) S------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CYTOCHROME------------------------------------------------------ PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ua5 B  29 KLPPGPRPLPLLGNLLQMDRRGLLKSFLRFREKYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNRWKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFHYQDQEFLKMLNLFYQTFSLISSVFGQLFELFSGFLKHFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPRDLIDTYLLHMEKEKSNA--EFSHQNLNLNTLSLFFAGTETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFSDLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGALKKTEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKIPPTYQIRFLPRH 492
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278|  |   288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488    
                                                                                                                                                                                                                                                                                    279  |                                                                                                                                                                                                                  
                                                                                                                                                                                                                                                                                       282

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Cytochrome P450 (480)

Superfamily: Cytochrome P450 (480)

Family: Cytochrome P450 (323)

Protein domain: automated matches (44)

Human (Homo sapiens) [TaxId: 9606] (17)

1a	d3ua5a_	A:
1b	d3ua5b_	B:

(no "CATH Domain" information available for 3UA5)

(no "Pfam Domain" information available for 3UA5)

Asymmetric Unit(hide GO term definitions)

Chain A,B (CP2B6_HUMAN | P20813)

molecular function
	GO:0008392	arachidonic acid epoxygenase activity	Catalysis of an NADPH- and oxygen-dependent reaction that converts arachidonic acid to a cis-epoxyeicosatrienoic acid.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004497	monooxygenase activity	Catalysis of the incorporation of one atom from molecular oxygen into a compound and the reduction of the other atom of oxygen to water.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from each of two donors, and molecular oxygen is reduced or incorporated into a donor.
	GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from reduced flavin or flavoprotein and one other donor, and one atom of oxygen is incorporated into one donor.
	GO:0019825	oxygen binding	Interacting selectively and non-covalently with oxygen (O2).
	GO:0008395	steroid hydroxylase activity	Catalysis of the formation of a hydroxyl group on a steroid by incorporation of oxygen from O2.
biological process
	GO:0042180	cellular ketone metabolic process	The chemical reactions and pathways involving any of a class of organic compounds that contain the carbonyl group, CO, and in which the carbonyl group is bonded only to carbon atoms, as carried out by individual cells. The general formula for a ketone is RCOR, where R and R are alkyl or aryl groups.
	GO:0017144	drug metabolic process	The chemical reactions and pathways involving a drug, a substance used in the diagnosis, treatment or prevention of a disease; as used here antibiotic substances (see antibiotic metabolism) are considered to be drugs, even if not used in medical or veterinary practice.
	GO:0019373	epoxygenase P450 pathway	The chemical reactions and pathways by which arachidonic acid is converted to other compounds including epoxyeicosatrienoic acids and dihydroxyeicosatrienoic acids.
	GO:0042738	exogenous drug catabolic process	The chemical reactions and pathways resulting in the breakdown of a drug that has originated externally to the cell or organism.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0008202	steroid metabolic process	The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
	GO:0006805	xenobiotic metabolic process	The chemical reactions and pathways involving a xenobiotic compound, a compound foreign to living organisms. Used of chemical compounds, e.g. a xenobiotic chemical, such as a pesticide.
cellular component
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0031090	organelle membrane	A membrane that is one of the two lipid bilayers of an organelle envelope or the outermost membrane of single membrane bound organelle.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		06X	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Arg A:48 - Arg A:49	[ RasMol ]
		Arg B:48 - Arg B:49	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3ua5
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CP2B6_HUMAN \| P20813
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.14.14.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CP2B6_HUMAN \| P20813
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CP2B6_HUMAN \| P20813	:	3ibd 3qoa 3qu8 4i91 4rql 4rrt 4zv8 5uap 5uda 5uec 5ufg

3ibd	HUMAN CYTOCHROME P450 2B6 (Y226H/K262R) IN COMPLEX WITH 4- (4-CHLOROPHENYL)IMIDAZOLE
3qoa	HUMAN CYTOCHROME P450 2B6 (Y226H/K262R) IN COMPLEX WITH 4- BENZYLPYRIDINE
3qu8	HUMAN CYTOCHROME P450 2B6 (Y226H/K262R) IN COMPLEX WITH 4- (4-NITROBENZYL)PYRIDINE

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (16, 31)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (22, 22)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File