3U73 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF STABILIZED HUMAN UPAR MUTANT IN COMPLEX WITH ATF

Authors :   M. D. Huang, X. Xu, C. Yuan

Date :   13 Oct 11 (Deposition) - 18 Apr 12 (Release) - 18 Apr 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.19

Chains :   Asym./Biol. Unit : A,U

Keywords :   Glycosylation, Hydrolase-Hydrolase Receptor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   X. Xu, H. Gardsvoll, C. Yuan, L. Lin, M. Ploug, M. Huang
Crystal Structure Of The Urokinase Receptor In A Ligand-Fre Form.
J. Mol. Biol. V. 416 629 2012
PubMed-ID: 22285761 | Reference-DOI: 10.1016/J.JMB.2011.12.058

Molecule 1 - UROKINASE PLASMINOGEN ACTIVATOR SURFACE RECEPTOR
	Chains	:	U
	Engineered	:	YES
	Expression System	:	DROSOPHILA MELANOGASTER
	Expression System Cell Line	:	S2 CELLS
	Expression System Plasmid	:	PMT/BIP
	Expression System Taxid	:	7227
	Expression System Vector Type	:	PLASMID
	Gene	:	MO3, PLAUR, UPAR
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	U-PAR, UPAR, MONOCYTE ACTIVATION ANTIGEN MO3

Molecule 2 - UROKINASE-TYPE PLASMINOGEN ACTIVATOR
	Chains	:	A
	EC Number	:	3.4.21.73
	Engineered	:	YES
	Expression System	:	DROSOPHILA MELANOGASTER
	Expression System Cell Line	:	S2 CELLS
	Expression System Plasmid	:	PMT/BIP
	Expression System Taxid	:	7227
	Expression System Vector Type	:	PLASMID
	Gene	:	PLAU
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	U-PLASMINOGEN ACTIVATOR, UPA, UROKINASE-TYPE PLASMINOGEN ACTIVATOR LONG CHAIN A, UROKINASE-TYPE PLASMINOGEN ACTIVATOR SHORT CHAIN A, UROKINASE-TYPE PLASMINOGEN ACTIVATOR CHAIN B

		1	2
Asymmetric/Biological Unit	:	A	U

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 7)

No.	Name	Count	Type	Full Name
1	MAN	1	Ligand/Ion	ALPHA-D-MANNOSE
2	NAG	6	Ligand/Ion	N-ACETYL-D-GLUCOSAMINE

Asymmetric Unit (7, 7)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASN U:52 , VAL U:70 , NAG U:502	BINDING SITE FOR RESIDUE NAG U 501
2	AC2	SOFTWARE	NAG U:501 , MAN U:503	BINDING SITE FOR RESIDUE NAG U 502
3	AC3	SOFTWARE	NAG U:502	BINDING SITE FOR RESIDUE MAN U 503
4	AC4	SOFTWARE	ASN U:162 , ASP U:163 , NAG U:505	BINDING SITE FOR RESIDUE NAG U 504
5	AC5	SOFTWARE	GLU U:132 , NAG U:504	BINDING SITE FOR RESIDUE NAG U 505
6	AC6	SOFTWARE	ASN U:200 , THR U:202 , GLN U:234 , NAG U:507	BINDING SITE FOR RESIDUE NAG U 506
7	AC7	SOFTWARE	GLN U:234 , NAG U:506	BINDING SITE FOR RESIDUE NAG U 507

Asymmetric/Biological Unit

No.	Residues
1	A:11	-	A:19
2	A:13	-	A:31
3	A:33	-	A:42
4	A:50	-	A:131
5	A:71	-	A:113
6	A:102	-	A:126
7	U:3	-	U:24
8	U:6	-	U:12
9	U:17	-	U:45
10	U:47	-	U:259
11	U:71	-	U:76
12	U:95	-	U:122
13	U:98	-	U:105
14	U:115	-	U:147
15	U:153	-	U:170
16	U:171	-	U:176
17	U:194	-	U:222
18	U:197	-	U:205
19	U:215	-	U:241
20	U:247	-	U:265
21	U:266	-	U:271

(no "Cis Peptide Bond" information available for 3U73)

Asymmetric/Biological Unit (6, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_016322	E	55	G	UPAR_HUMAN	Polymorphism	4251813	U	E	33	G
2	UniProt	VAR_016323	T	86	A	UPAR_HUMAN	Polymorphism	399145	U	T	64	A
3	UniProt	VAR_006722	P	141	L	UROK_HUMAN	Polymorphism	2227564	A	P	121	L
4	UniProt	VAR_016325	K	220	R	UPAR_HUMAN	Polymorphism	2302524	U	K	198	R
5	UniProt	VAR_016326	N	281	K	UPAR_HUMAN	Polymorphism	4251921	U	C	259	K
6	UniProt	VAR_052698	D	297	A	UPAR_HUMAN	Polymorphism	16976608	U	D	275	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (4, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LY6_UPAR	PS00983	Ly-6 / u-PAR domain signature.	UPAR_HUMAN	24-67 116-169 215-269	3	U:2-45 U:94-147 U:193-247
2	EGF_1	PS00022	EGF-like domain signature 1.	UROK_HUMAN	51-62	1	A:31-42
3	KRINGLE_2	PS50070	Kringle domain profile.	UROK_HUMAN	69-151	1	A:49-131
4	KRINGLE_1	PS00021	Kringle domain signature.	UROK_HUMAN	121-133	1	A:101-113

Asymmetric/Biological Unit (9, 9)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000340093	1	ENSE00001048170	chr19:44174502-44174218	285	UPAR_HUMAN	1-19	19	0	-	-
1.2	ENST00000340093	2	ENSE00000847438	chr19:44171843-44171733	111	UPAR_HUMAN	19-56	38	1	U:1-34	34
1.3	ENST00000340093	3	ENSE00000494759	chr19:44169611-44169468	144	UPAR_HUMAN	56-104	49	1	U:34-80	47
1.4	ENST00000340093	4	ENSE00000710867	chr19:44160792-44160631	162	UPAR_HUMAN	104-158	55	1	U:92-136	45
1.5	ENST00000340093	5	ENSE00000710856	chr19:44159725-44159591	135	UPAR_HUMAN	158-203	46	1	U:136-181	46
1.6	ENST00000340093	6	ENSE00000847435	chr19:44156523-44156377	147	UPAR_HUMAN	203-252	50	1	U:181-230	50
1.7	ENST00000340093	7	ENSE00000847434	chr19:44153295-44152732	564	UPAR_HUMAN	252-335	84	1	U:230-280	51

2.3c	ENST00000372764	3c	ENSE00001820360	chr10:75670915-75670976	62	UROK_HUMAN	-	0	0	-	-
2.4b	ENST00000372764	4b	ENSE00002193721	chr10:75671283-75671370	88	UROK_HUMAN	1-19	19	0	-	-
2.5	ENST00000372764	5	ENSE00001276413	chr10:75671799-75671826	28	UROK_HUMAN	20-29	10	0	-	-
2.6a	ENST00000372764	6a	ENSE00001169210	chr10:75671973-75672080	108	UROK_HUMAN	29-65	37	1	A:10-45	36
2.7b	ENST00000372764	7b	ENSE00001169200	chr10:75672682-75672856	175	UROK_HUMAN	65-123	59	1	A:45-103	59
2.8	ENST00000372764	8	ENSE00000834105	chr10:75673048-75673139	92	UROK_HUMAN	123-154	32	1	A:103-132	30
2.9b	ENST00000372764	9b	ENSE00001169184	chr10:75673297-75673516	220	UROK_HUMAN	154-227	74	0	-	-
2.10	ENST00000372764	10	ENSE00001169178	chr10:75673738-75673886	149	UROK_HUMAN	227-277	51	0	-	-
2.11	ENST00000372764	11	ENSE00001169173	chr10:75674534-75674674	141	UROK_HUMAN	277-324	48	0	-	-
2.13	ENST00000372764	13	ENSE00001169164	chr10:75675009-75675157	149	UROK_HUMAN	324-373	50	0	-	-
2.14d	ENST00000372764	14d	ENSE00001892698	chr10:75676147-75677255	1109	UROK_HUMAN	374-431	58	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:123
 aligned with UROK_HUMAN | P00749 from UniProtKB/Swiss-Prot  Length:431

    Alignment length:123
                                    39        49        59        69        79        89        99       109       119       129       139       149   
           UROK_HUMAN    30 NCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCA 152
               SCOP domains d3u73a1 A:10-49                         d3u73a2 A:50-132 Urokinase-type plasminogen activator                               SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeee.....eeee.............................................hhhhh........hhhhhh................eeeeee..eeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------L----------- SAPs(SNPs)
                PROSITE (2) ---------------------EGF_1       ------KRINGLE_2  PDB: A:49-131 UniProt: 69-151                                           - PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------KRINGLE_1    ------------------- PROSITE (3)
           Transcript 2 (1) Exon 2.6a  PDB: A:10-45 [INCOMPLETE]---------------------------------------------------------Exon 2.8  PDB: A:103-132       Transcript 2 (1)
           Transcript 2 (2) -----------------------------------Exon 2.7b  PDB: A:45-103 UniProt: 65-123                   ----------------------------- Transcript 2 (2)
                 3u73 A  10 NCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCA 132
                                    19        29        39        49        59        69        79        89        99       109       119       129

Chain U from PDB  Type:PROTEIN  Length:269
 aligned with UPAR_HUMAN | Q03405 from UniProtKB/Swiss-Prot  Length:335

    Alignment length:280
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302
           UPAR_HUMAN    23 LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQY 302
               SCOP domains d3u73u1 U:1-80 automated matches                                                -----------d3u73u2 U:92-187 automated matches                                                              d3u73u3 U:188-280 automated matches                                                           SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.........eee......eeeeeeeeee....eeeeeeeeee......eeeeeee..eeeeeeeeee...hhhhh.-----------.eeeeeee...........eeeee.....eeeeeeeee..............eeeeee.....eeeeeee..eeeeeeee...........hhhhh.eeeeeeeeeee...........eeeeee....eeeeeeee........eeeeee.hhhhh..hhhhhhh.eeeeeeee......hhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------G------------------------------A-------------------------------------------------------------------------------------------------------------------------------------R------------------------------------------------------------K---------------A----- SAPs(SNPs)
                    PROSITE -LY6_UPAR  PDB: U:2-45 UniProt: 24-67        ------------------------------------------------LY6_UPAR  PDB: U:94-147 UniProt: 116-169              ---------------------------------------------LY6_UPAR  PDB: U:193-247 UniProt: 215-269              --------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: U:1-34 [INCOMPLETE]-----------------------------------------------Exon 1.4  PDB: U:92-136 UniProt: 104-158 [INCOMPLETE]  --------------------------------------------Exon 1.6  PDB: U:181-230 UniProt: 203-252         -------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------Exon 1.3  PDB: U:34-80 UniProt: 56-104           -----------------------------------------------------Exon 1.5  PDB: U:136-181 UniProt: 158-203     ------------------------------------------------Exon 1.7  PDB: U:230-280 UniProt: 252-335           Transcript 1 (2)
                 3u73 U   1 LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTCSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGN-----------YLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMCHIDVSCCTKSGCNHPDLDVQY 280
                                    10        20        30        40        50        60        70        80         - |     100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280
                                                                                                          80          92

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "CATH Domain" information available for 3U73)

(no "Pfam Domain" information available for 3U73)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (UROK_HUMAN | P00749)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
	GO:0008236	serine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0001525	angiogenesis	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
	GO:0007596	blood coagulation	The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
	GO:0071498	cellular response to fluid shear stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a fluid shear stress stimulus. Fluid shear stress is the force acting on an object in a system where the fluid is moving across a solid surface.
	GO:0071333	cellular response to glucose stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucose stimulus.
	GO:0035729	cellular response to hepatocyte growth factor stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hepatocyte growth factor stimulus.
	GO:0071456	cellular response to hypoxia	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
	GO:0071222	cellular response to lipopolysaccharide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0071310	cellular response to organic substance	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
	GO:0072734	cellular response to staurosporine	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a staurosporine stimulus.
	GO:0006935	chemotaxis	The directed movement of a motile cell or organism, or the directed growth of a cell guided by a specific chemical concentration gradient. Movement may be towards a higher concentration (positive chemotaxis) or towards a lower concentration (negative chemotaxis).
	GO:0007566	embryo implantation	Attachment of the blastocyst to the uterine lining.
	GO:0042730	fibrinolysis	A process that solubilizes fibrin in the bloodstream of a multicellular organism, chiefly by the proteolytic action of plasmin.
	GO:0007599	hemostasis	The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
	GO:0070997	neuron death	The process of cell death in a neuron.
	GO:0030335	positive regulation of cell migration	Any process that activates or increases the frequency, rate or extent of cell migration.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0060279	positive regulation of ovulation	Any process that activates or increases the frequency, rate or extent of ovulation, the release of a mature ovum/oocyte from an ovary.
	GO:2000379	positive regulation of reactive oxygen species metabolic process	Any process that activates or increases the frequency, rate or extent of reactive oxygen species metabolic process.
	GO:0014911	positive regulation of smooth muscle cell migration	Any process that activates, maintains or increases the frequency, rate or extent of smooth muscle cell migration.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0033628	regulation of cell adhesion mediated by integrin	Any process that modulates the frequency, rate, or extent of cell adhesion mediated by integrin.
	GO:0042127	regulation of cell proliferation	Any process that modulates the frequency, rate or extent of cell proliferation.
	GO:2000345	regulation of hepatocyte proliferation	Any process that modulates the frequency, rate or extent of hepatocyte proliferation.
	GO:0010469	regulation of receptor activity	Any process that modulates the frequency, rate or extent of receptor activity. Receptor activity is when a molecule combines with an extracellular or intracellular messenger to initiate a change in cell activity.
	GO:0014910	regulation of smooth muscle cell migration	Any process that modulates the frequency, rate or extent of smooth muscle cell migration.
	GO:2000097	regulation of smooth muscle cell-matrix adhesion	Any process that modulates the frequency, rate or extent of smooth muscle cell-matrix adhesion.
	GO:0061041	regulation of wound healing	Any process that modulates the rate, frequency, or extent of the series of events that restore integrity to a damaged tissue, following an injury.
	GO:0014823	response to activity	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an activity stimulus.
	GO:0035728	response to hepatocyte growth factor	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hepatocyte growth factor stimulus.
	GO:0055093	response to hyperoxia	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating increased oxygen tension.
	GO:0001666	response to hypoxia	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0043403	skeletal muscle tissue regeneration	The regrowth of skeletal muscle tissue to repair injured or damaged muscle fibers in the postnatal stage.
	GO:0014909	smooth muscle cell migration	The orderly movement of a smooth muscle cell from one site to another, often during the development of a multicellular organism.
	GO:0007283	spermatogenesis	The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
	GO:0042060	wound healing	The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain U (UPAR_HUMAN | Q03405)

molecular function
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
	GO:0004872	receptor activity	Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0030377	urokinase plasminogen activator receptor activity	Combining with the urokinase plasminogen activator to initiate a change in cell activity.
biological process
	GO:0016255	attachment of GPI anchor to protein	A transamidation reaction that results in the cleavage of the polypeptide chain and the concomitant transfer of the GPI anchor to the newly formed carboxy-terminal amino acid of the anchored protein. The cleaved C-terminal contains the C-terminal GPI signal sequence of the newly synthesized polypeptide chain.
	GO:0007596	blood coagulation	The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
	GO:0006935	chemotaxis	The directed movement of a motile cell or organism, or the directed growth of a cell guided by a specific chemical concentration gradient. Movement may be towards a higher concentration (positive chemotaxis) or towards a lower concentration (negative chemotaxis).
	GO:0042730	fibrinolysis	A process that solubilizes fibrin in the bloodstream of a multicellular organism, chiefly by the proteolytic action of plasmin.
	GO:0006928	movement of cell or subcellular component	The directed, self-propelled movement of a cell or subcellular component without the involvement of an external agent such as a transporter or a pore.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	Any process that stops, prevents or reduces the frequency, rate or extent of cysteine-type endopeptidase activity involved in apoptotic signaling pathway.
	GO:2001243	negative regulation of intrinsic apoptotic signaling pathway	Any process that stops, prevents or reduces the frequency, rate or extent of intrinsic apoptotic signaling pathway.
	GO:0043388	positive regulation of DNA binding	Any process that increases the frequency, rate or extent of DNA binding. DNA binding is any process in which a gene product interacts selectively with DNA (deoxyribonucleic acid).
	GO:0045742	positive regulation of epidermal growth factor receptor signaling pathway	Any process that activates or increases the frequency, rate or extent of epidermal growth factor receptor signaling pathway activity.
	GO:0001934	positive regulation of protein phosphorylation	Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
	GO:0090200	positive regulation of release of cytochrome c from mitochondria	Any process that increases the rate, frequency or extent of release of cytochrome c from mitochondria, the process in which cytochrome c is enabled to move from the mitochondrial intermembrane space into the cytosol, which is an early step in apoptosis and leads to caspase activation.
	GO:0030162	regulation of proteolysis	Any process that modulates the frequency, rate or extent of the hydrolysis of a peptide bond or bonds within a protein.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0038195	urokinase plasminogen activator signaling pathway	A series of molecular signals initiated by the binding of urokinase plasminogen activator to a receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:0031225	anchored component of membrane	The component of a membrane consisting of the gene products that are tethered to the membrane only by a covalently attached anchor, such as a lipid group that is embedded in the membrane. Gene products with peptide sequences that are embedded in the membrane are excluded from this grouping.
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0005788	endoplasmic reticulum lumen	The volume enclosed by the membranes of the endoplasmic reticulum.
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0019898	extrinsic component of membrane	The component of a membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0071438	invadopodium membrane	The portion of the plasma membrane surrounding an invadopodium.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MAN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NAG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3u73)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3u73
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	UPAR_HUMAN \| Q03405
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	UROK_HUMAN \| P00749
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.21.73
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	UPAR_HUMAN \| Q03405
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	UROK_HUMAN \| P00749
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 7)

Sites (7, 7)

SS Bonds (21, 21)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (6, 6)

PROSITE Motifs (4, 6)

Exons (9, 9)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 5)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (73, 83)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File