|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 3MUS) |
(no "Cis Peptide Bond" information available for 3MUS) |
(no "SAP(SNP)/Variant" information available for 3MUS) |
Asymmetric Unit (2, 4)
|
Asymmetric Unit (3, 6)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:85 aligned with CYB5B_RAT | P04166 from UniProtKB/Swiss-Prot Length:146 Alignment length:85 27 37 47 57 67 77 87 97 CYB5B_RAT 18 PAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKP 102 SCOP domains d3musa_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) --CYTOCHROME_B5_2 PDB: A:4-80 UniProt: 20-96 ------ PROSITE (1) PROSITE (2) ---------------------------------CYTOCHRO-------------------------------------------- PROSITE (2) Transcript 1 Exon 1.1 PDB: A:2-38 UniProt: 1-54 Exon 1.2 PDB: A:39-81 UniProt: 55-97 1.3 Transcript 1 3mus A 2 PAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKP 86 11 21 31 41 51 61 71 81 Chain B from PDB Type:PROTEIN Length:87 aligned with CYB5B_RAT | P04166 from UniProtKB/Swiss-Prot Length:146 Alignment length:87 26 36 46 56 66 76 86 96 CYB5B_RAT 17 DPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKPK 103 SCOP domains d3musb_ B: automated matches SCOP domains CATH domains --------------------------------------------------------------------------------------- CATH domains Pfam domains (1) -----Cyt-b5-3musB01 B:6-80 ------- Pfam domains (1) Pfam domains (2) -----Cyt-b5-3musB02 B:6-80 ------- Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---CYTOCHROME_B5_2 PDB: B:4-80 UniProt: 20-96 ------- PROSITE (1) PROSITE (2) ----------------------------------CYTOCHRO--------------------------------------------- PROSITE (2) Transcript 1 Exon 1.1 PDB: B:1-38 UniProt: 1-54 Exon 1.2 PDB: B:39-81 UniProt: 55-97 1.3 Transcript 1 3mus B 1 DPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKPA 87 10 20 30 40 50 60 70 80
|
Asymmetric Unit
|
(no "CATH Domain" information available for 3MUS) |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B (CYB5B_RAT | P04166)
|
|
|
|
|
|
|