|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 7)
|
Asymmetric Unit (7, 7)
|
(no "SS Bond" information available for 1LJ0) |
(no "Cis Peptide Bond" information available for 1LJ0) |
(no "SAP(SNP)/Variant" information available for 1LJ0) |
Asymmetric Unit (2, 8)
|
Asymmetric Unit (3, 12)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:89 aligned with CYB5B_RAT | P04166 from UniProtKB/Swiss-Prot Length:146 Alignment length:89 24 34 44 54 64 74 84 94 CYB5B_RAT 15 GSDPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKPK 103 SCOP domains d1lj0a_ A: Cytochrome b5 SCOP domains CATH domains 1lj0A00 A:-1-87 Flavocytochrome B2, subunit A, domain 1 CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----CYTOCHROME_B5_2 PDB: A:4-80 UniProt: 20-96 ------- PROSITE (1) PROSITE (2) ------------------------------------CYTOCHRO--------------------------------------------- PROSITE (2) Transcript 1 Exon 1.1 PDB: A:-1-38 UniProt: 1-54 Exon 1.2 PDB: A:39-81 UniProt: 55-97 1.3 Transcript 1 1lj0 A -1 GSDPAVTYYRLEEVAKRNTSEETWMVLHGRVYDLTRFLSEHPGGEEVLREQAGADATESFEDVGHSPDAREMSKQYYIGDVHPNDLKPK 87 8 18 28 38 48 58 68 78 Chain B from PDB Type:PROTEIN Length:89 aligned with CYB5B_RAT | P04166 from UniProtKB/Swiss-Prot Length:146 Alignment length:89 24 34 44 54 64 74 84 94 CYB5B_RAT 15 GSDPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKPK 103 SCOP domains d1lj0b_ B: Cytochrome b5 SCOP domains CATH domains 1lj0B00 B:-1-87 Flavocytochrome B2, subunit A, domain 1 CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----CYTOCHROME_B5_2 PDB: B:4-80 UniProt: 20-96 ------- PROSITE (1) PROSITE (2) ------------------------------------CYTOCHRO--------------------------------------------- PROSITE (2) Transcript 1 Exon 1.1 PDB: B:-1-38 UniProt: 1-54 Exon 1.2 PDB: B:39-81 UniProt: 55-97 1.3 Transcript 1 1lj0 B -1 GSDPAVTYYRLEEVAKRNTSEETWMVLHGRVYDLTRFLSEHPGGEEVLREQAGADATESFEDVGHSPDAREMSKQYYIGDVHPNDLKPK 87 8 18 28 38 48 58 68 78 Chain C from PDB Type:PROTEIN Length:88 aligned with CYB5B_RAT | P04166 from UniProtKB/Swiss-Prot Length:146 Alignment length:88 24 34 44 54 64 74 84 94 CYB5B_RAT 15 GSDPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKP 102 SCOP domains d1lj0c_ C: Cytochrome b5 SCOP domains CATH domains 1lj0C00 C:-1-86 Flavocytochrome B2, subunit A, domain 1 CATH domains Pfam domains ---------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----CYTOCHROME_B5_2 PDB: C:4-80 UniProt: 20-96 ------ PROSITE (1) PROSITE (2) ------------------------------------CYTOCHRO-------------------------------------------- PROSITE (2) Transcript 1 Exon 1.1 PDB: C:-1-38 UniProt: 1-54 Exon 1.2 PDB: C:39-81 UniProt: 55-97 1.3 Transcript 1 1lj0 C -1 GSDPAVTYYRLEEVAKRNTSEETWMVLHGRVYDLTRFLSEHPGGEEVLREQAGADATESFEDVGHSPDAREMSKQYYIGDVHPNDLKP 86 8 18 28 38 48 58 68 78 Chain D from PDB Type:PROTEIN Length:86 aligned with CYB5B_RAT | P04166 from UniProtKB/Swiss-Prot Length:146 Alignment length:86 27 37 47 57 67 77 87 97 CYB5B_RAT 18 PAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKPK 103 SCOP domains d1lj0d_ D: Cytochrome b5 SCOP domains CATH domains 1lj0D00 D:2-87 Flavocytochrome B2, subunit A, domain 1 CATH domains Pfam domains (1) ----Cyt-b5-1lj0D01 D:6-80 ------- Pfam domains (1) Pfam domains (2) ----Cyt-b5-1lj0D02 D:6-80 ------- Pfam domains (2) Pfam domains (3) ----Cyt-b5-1lj0D03 D:6-80 ------- Pfam domains (3) Pfam domains (4) ----Cyt-b5-1lj0D04 D:6-80 ------- Pfam domains (4) SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) --CYTOCHROME_B5_2 PDB: D:4-80 UniProt: 20-96 ------- PROSITE (1) PROSITE (2) ---------------------------------CYTOCHRO--------------------------------------------- PROSITE (2) Transcript 1 Exon 1.1 PDB: D:2-38 UniProt: 1-54 Exon 1.2 PDB: D:39-81 UniProt: 55-97 1.3 Transcript 1 1lj0 D 2 PAVTYYRLEEVAKRNTSEETWMVLHGRVYDLTRFLSEHPGGEEVLREQAGADATESFEDVGHSPDAREMSKQYYIGDVHPNDLKPK 87 11 21 31 41 51 61 71 81
|
Asymmetric Unit
|
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D (CYB5B_RAT | P04166)
|
|
|
|
|
|
|