|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 4)| Asymmetric/Biological Unit (3, 4) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3NER) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3NER) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3NER) |
PROSITE Motifs (2, 4)
Asymmetric/Biological Unit (2, 4)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3NER) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:90 aligned with CYB5B_HUMAN | O43169 from UniProtKB/Swiss-Prot Length:146 Alignment length:90 22 32 42 52 62 72 82 92 102 CYB5B_HUMAN 13 GQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKP 102 SCOP domains d3nera_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) -------CYTOCHROME_B5_2 PDB: A:4-80 UniProt: 20-96 ------ PROSITE (1) PROSITE (2) --------------------------------------CYTOCHRO-------------------------------------------- PROSITE (2) Transcript ------------------------------------------------------------------------------------------ Transcript 3ner A -3 GQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKP 86 6 16 26 36 46 56 66 76 86 Chain B from PDB Type:PROTEIN Length:91 aligned with CYB5B_HUMAN | O43169 from UniProtKB/Swiss-Prot Length:146 Alignment length:91 21 31 41 51 61 71 81 91 101 CYB5B_HUMAN 12 KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKP 102 SCOP domains d3nerb_ B: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) ----------Cyt-b5-3nerB01 B:6-80 ------ Pfam domains (1) Pfam domains (2) ----------Cyt-b5-3nerB02 B:6-80 ------ Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) --------CYTOCHROME_B5_2 PDB: B:4-80 UniProt: 20-96 ------ PROSITE (1) PROSITE (2) ---------------------------------------CYTOCHRO-------------------------------------------- PROSITE (2) Transcript ------------------------------------------------------------------------------------------- Transcript 3ner B -4 KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKP 86 5 15 25 35 45 55 65 75 85
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3NER) |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (7, 7)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (CYB5B_HUMAN | O43169)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|