3IYP - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   THE INTERACTION OF DECAY-ACCELERATING FACTOR WITH ECHOVIRUS 7

Authors :   P. Plevka, S. Hafenstein, Y. Zhang, K. G. Harris, J. O. Cifuente, V. D. Bo P. R. Chipman, F. Lin, D. E. Medof, C. M. Bator, M. G. Rossmann

Date :   07 Apr 10 (Deposition) - 24 Nov 10 (Release) - 09 Nov 16 (Revision)

Method :   ELECTRON MICROSCOPY

Resolution :   7.20

Chains :   Asym. Unit : A,B,C,D,F
Biol. Unit 1: A,B,C,D,F  (60x)

Keywords :   Virus, Receptor, Complex, Echovirus, Daf, Icosahedral Virus (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. Plevka, S. Hafenstein, K. G. Harris, J. O. Cifuente, Y. Zhang, V. D. Bowman, P. R. Chipman, C. M. Bator, F. Lin, M. E. Medof, M. G. Rossmann
Interaction Of Decay-Accelerating Factor With Echovirus 7.
J. Virol. V. 84 12665 2010
PubMed-ID: 20881044 | Reference-DOI: 10.1128/JVI.00837-10

Molecule 1 - CAPSID PROTEIN
	Chains	:	A
	Organism Scientific	:	HUMAN ECHOVIRUS 7
	Organism Taxid	:	46018

Molecule 2 - POLYPROTEIN
	Chains	:	B
	Organism Scientific	:	HUMAN ECHOVIRUS 7
	Organism Taxid	:	46018

Molecule 3 - POLYPROTEIN
	Chains	:	C
	Organism Scientific	:	HUMAN ECHOVIRUS 7
	Organism Taxid	:	46018

Molecule 4 - POLYPROTEIN
	Chains	:	D
	Organism Scientific	:	HUMAN ECHOVIRUS 7
	Organism Taxid	:	46018

Molecule 5 - COMPLEMENT DECAY-ACCELERATING FACTOR
	Chains	:	F
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1	2	3	4	5
Asymmetric Unit	:	A	B	C	D	F
Biological Unit 1 (60x)	:	A	B	C	D	F

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 1)

No.	Name	Count	Type	Full Name
1	DAO	1	Ligand/Ion	LAURIC ACID

Biological Unit 1 (1, 60)

No.	Name	Count	Type	Full Name
1	DAO	60	Ligand/Ion	LAURIC ACID

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ILE A:95 , PHE A:107 , MET A:117 , TYR A:146 , MET A:181 , ILE A:183 , ASN A:194 , TYR A:210 , MET A:216	BINDING SITE FOR RESIDUE DAO A 1289

Asymmetric Unit

No.	Residues
1	F:4	-	F:49
2	F:33	-	F:62
3	F:66	-	F:113
4	F:97	-	F:126
5	F:131	-	F:172
6	F:158	-	F:188
7	F:193	-	F:235
8	F:221	-	F:251

Asymmetric Unit

No.	Residues
1	Phe C:81	-	Pro C:82
2	Glu F:18	-	Gly F:19
3	Gln F:79	-	Pro F:80
4	Pro F:99	-	Gly F:100
5	Asn F:238	-	Asn F:239

Asymmetric Unit (6, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_001997	R	52	L	DAF_HUMAN	Polymorphism	28371588	F	R	20	L
2	UniProt	VAR_001998	R	52	P	DAF_HUMAN	Polymorphism	28371588	F	R	20	P
3	UniProt	VAR_001999	L	82	R	DAF_HUMAN	Polymorphism	147474393	F	L	50	R
4	UniProt	VAR_002000	S	199	L	DAF_HUMAN	Polymorphism	56283594	F	S	167	L
5	UniProt	VAR_002001	A	227	P	DAF_HUMAN	Polymorphism	60822373	F	A	195	P
6	UniProt	VAR_015884	R	240	H	DAF_HUMAN	Polymorphism	199705465	F	R	208	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (6, 360)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_001997	R	52	L	DAF_HUMAN	Polymorphism	28371588	F	R	20	L
2	UniProt	VAR_001998	R	52	P	DAF_HUMAN	Polymorphism	28371588	F	R	20	P
3	UniProt	VAR_001999	L	82	R	DAF_HUMAN	Polymorphism	147474393	F	L	50	R
4	UniProt	VAR_002000	S	199	L	DAF_HUMAN	Polymorphism	56283594	F	S	167	L
5	UniProt	VAR_002001	A	227	P	DAF_HUMAN	Polymorphism	60822373	F	A	195	P
6	UniProt	VAR_015884	R	240	H	DAF_HUMAN	Polymorphism	199705465	F	R	208	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SUSHI	PS50923	Sushi/CCP/SCR domain profile.	DAF_HUMAN	96-160 34-94 161-222 223-285	4	F:64-128 F:3-62 F:129-190 F:191-253

Biological Unit 1 (1, 240)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SUSHI	PS50923	Sushi/CCP/SCR domain profile.	DAF_HUMAN	96-160 34-94 161-222 223-285	240	F:64-128 F:3-62 F:129-190 F:191-253

Asymmetric Unit (7, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000367064	1a	ENSE00001840627	chr1:207494853-207495210	358	DAF_HUMAN	1-34	34	1	F:2-2	1
1.3	ENST00000367064	3	ENSE00001443405	chr1:207495727-207495912	186	DAF_HUMAN	34-96	63	1	F:2-64	63
1.4b	ENST00000367064	4b	ENSE00001443404	chr1:207497904-207498095	192	DAF_HUMAN	96-160	65	1	F:64-128	65
1.5	ENST00000367064	5	ENSE00001069638	chr1:207498967-207499066	100	DAF_HUMAN	160-193	34	1	F:128-161	34
1.6	ENST00000367064	6	ENSE00001069637	chr1:207500097-207500182	86	DAF_HUMAN	193-222	30	1	F:161-190	30
1.7	ENST00000367064	7	ENSE00000960173	chr1:207504453-207504641	189	DAF_HUMAN	222-285	64	1	F:190-253	64
1.8b	ENST00000367064	8b	ENSE00001041396	chr1:207510038-207510163	126	DAF_HUMAN	285-327	43	1	F:253-253	1
1.8d	ENST00000367064	8d	ENSE00001253047	chr1:207510674-207510754	81	DAF_HUMAN	327-354	28	0	-	-
1.9	ENST00000367064	9	ENSE00001432766	chr1:207512742-207512762	21	DAF_HUMAN	354-361	8	0	-	-
1.15f	ENST00000367064	15f	ENSE00001631743	chr1:207532891-207534311	1421	DAF_HUMAN	361-381	21	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:277
 aligned with Q9QP24_9ENTO | Q9QP24 from UniProtKB/TrEMBL  Length:292

    Alignment length:277
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       
         Q9QP24_9ENTO    11 IARVADTVASGPSNSTSIPALTAVETGHTSQVEPSDTMQTRHVKNYHSRSESTVENFLSRSACVYIEEYYTKDQDNVNRYMSWTINARRMVQLRRKFELFTYMRFDMEITFVITSRQLPGTSIAQDMPPLTHQIMYIPPGGPVPNSVTDFAWQTSTNPSIFWTEGNAPPRMSIPFISIGNAYSNFYDGWSHFSQNGVYGYNALNNMGKLYARHVNKDTPYQMSSTIRVYFKPKHIRVWVPRPPRLSPYIKSSNVNFNPTNLTDERSSITYVPDTIRP 287
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....................eehhhhh.....hhhhh...............hhhhhhh..eeeeeeeee.........ee........hhhhhhhhh.eeeeeeeeeeeeeeeeee.............eeeeeee...........hhhhhh....eeeee......eeee........ee.....eee...eeee.hhhh....eeeeee........eeeeeeeeeeeeeeeeeee..................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3iyp A  11 IARVADTVASGPSNSTSIPALTAVETGHTSQVEPSDTMQTRHVKNYHSRSESTVENFLSRSACVYIEEYYTKDQDNVNRYMSWTINARRMVQLRRKFELFTYMRFDMEITFVITSRQLPGTSIAQDMPPLTHQIMYIPPGGPVPNSVTDFAWQTSTNPSIFWTEGNAPPRMSIPFISIGNAYSNFYDGWSHFSQNGVYGYNALNNMGKLYARHVNKDTPYQMSSTIRVYFKPKHIRVWVPRPPRLSPYIKSSNVNFNPTNLTDERSSITYVPDTIRP 287
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280

Chain B from PDB  Type:PROTEIN  Length:238
 aligned with Q6W9E5_9ENTO | Q6W9E5 from UniProtKB/TrEMBL  Length:2194

    Alignment length:238
                                   340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560        
         Q6W9E5_9ENTO   331 GLPVLNTPGSNQFMTSDDFQSPSAMPQFDVTPHMDIPGEVHNLMEIAEVDSVVPVNNIKANLQSMDAYHIEVNTGNYQGEKIFAFQMQPGLESVFKRTLMGEILNYYAHWSGSIKLTFTFCGSAMATGKLLLAYSPPGADVPATRKQAMLGTHMIWDIGLQSSCVLCIPWISQTHYRLVQQDEYTSAGNVTCWYQTGIVVPPGTPNKCVVLCFASACNDFSVRMLRDTPFIGQTALLQ 568
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......................................ee..hhhhhh..ee.....hhhhh.hhhhh..eee.........eeee...........hhhhhhhh...eee..eeeeeee........eeeeeee........hhhhhhh.eeeeee.....eeeeee........ee..........eeeeee............eeeeeeeeee....ee................ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3iyp B   1 GLPVLNTPGSNQFMTSDDFQSPSAMPQFDVTPHMDIPGEVHNLMEIAEVDSVVPVNNIKANLQSMDAYHIEVNTGNYQGEKIFAFQMQPGLESVFKRTLMGEILNYYAHWSGSIKLTFTFCGSAMATGKLLLAYSPPGADVPATRKQAMLGTHMIWDIGLQSSCVLCIPWISQTHYRLVQQDEYTSAGNVTCWYQTGIVVPPGTPNKCVVLCFASACNDFSVRMLRDTPFIGQTALLQ 238
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230

Chain C from PDB  Type:PROTEIN  Length:252
 aligned with Q6W9E5_9ENTO | Q6W9E5 from UniProtKB/TrEMBL  Length:2194

    Alignment length:252
                                    88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328  
         Q6W9E5_9ENTO    79 SDRVRSLTLGNSTITTQESANVVVGYGRWPEYLRDDEATAEDQPTQPDVATCRFYTLESVQWEKNSAGWWWKFPEALKDMGLFGQNMLYHYLGRAGYTIHVQCNASKFHQGCLLVVCVPEAEMGCSQTDKEVAAMNLTKGEAAHKFEPTKTNGEHTVQSIVCNAGMGVGVGNLTIYPHQWINLRTNNCATIVMPYVNSVPMDNMFRHYNFTLMVIPFAPLDYAAQASEYVPVTVTIAPMCAEYNGLRLAYQQ 330
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeee..eeeee......ee......................hhhhh...ee...eee......eeeeehhhhh.hhhhhhhhhheeeee...eeeee.......eeeeeeeeee.............hhhhhh.....ee..............hhhhh....hhhhhhhh.eeeee.....eeeee.................eeeeeeeeeeee........eeeeeeee....eeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3iyp C   9 SDRVRSLTLGNSTITTQESANVVVGYGRWPEYLRDDEATAEDQPTQPDVATCRFYTLESVQWEKNSAGWWWKFPEALKDMGLFGQNMLYHYLGRAGYTIHVQCNASKFHQGCLLVVCVPEAEMGCSQTDKEVAAMNLTKGEAAHKFEPTKTNGEHTVQSIVCNAGMGVGVGNLTIYPHQWINLRTNNCATIVMPYVNSVPMDNMFRHYNFTLMVIPFAPLDYAAQASEYVPVTVTIAPMCAEYNGLRLAYQQ 260
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258

Chain D from PDB  Type:PROTEIN  Length:61
 aligned with Q91QV1_9ENTO | Q91QV1 from UniProtKB/TrEMBL  Length:146

    Alignment length:69
                                    10        20        30        40        50        60         
         Q91QV1_9ENTO     1 MGAQVSTQKTGAHETGLNASGNSIIHYTNINYYKDAASNSANRQDFTQDPGKFTEPVKDIMIKTMPALN  69
               SCOP domains --------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee........--------..eeee.....hhhhh..........hhhhhh.............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------- Transcript
                 3iyp D   1 MGAQVSTQKTGAHET--------IIHYTNINYYKDAASNSANRQDFTQDPGKFTEPVKDIMIKTMPALN  69
                                    10    |    -   |    30        40        50        60         
                                         15       24

Chain F from PDB  Type:PROTEIN  Length:252
 aligned with DAF_HUMAN | P08174 from UniProtKB/Swiss-Prot  Length:381

    Alignment length:252
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283  
            DAF_HUMAN    34 GDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRG 285
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .ee........eee.......ee...eeeeee...eee......eeeee...ee......eee..........eee..hhhhh.......eeeeee...eee......eee.............eee...........eeee.........eeeeee...eeee...eeeeeee..eeee.....eeee...........eeee..........eeeeee....eee...eeeee......ee.....eee. Sec.struct. author
             SAPs(SNPs) (1) ------------------L-----------------------------R--------------------------------------------------------------------------------------------------------------------L---------------------------P------------H--------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------P----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE SUSHI  PDB: F:3-62 UniProt: 34-94                            -SUSHI  PDB: F:64-128 UniProt: 96-160                             SUSHI  PDB: F:129-190 UniProt: 161-222                        SUSHI  PDB: F:191-253 UniProt: 223-285                          PROSITE
           Transcript 1 (1) 1-------------------------------------------------------------Exon 1.4b  PDB: F:64-128 UniProt: 96-160                         --------------------------------Exon 1.6  PDB: F:161-190      --------------------------------------------------------------1 Transcript 1 (1)
           Transcript 1 (2) Exon 1.3  PDB: F:2-64 UniProt: 34-96                           ---------------------------------------------------------------Exon 1.5  PDB: F:128-161          ----------------------------Exon 1.7  PDB: F:190-253 UniProt: 222-285                        Transcript 1 (2)
                 3iyp F   2 QDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRG 253
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3IYP)

(no "CATH Domain" information available for 3IYP)

(no "Pfam Domain" information available for 3IYP)

Asymmetric Unit(hide GO term definitions)

Chain A (Q9QP24_9ENTO | Q9QP24)

molecular function
	GO:0005198	structural molecule activity	The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
cellular component
	GO:0019028	viral capsid	The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
	GO:0019012	virion	The complete fully infectious extracellular virus particle.

Chain B,C (Q6W9E5_9ENTO | Q6W9E5)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0003724	RNA helicase activity	Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a RNA helix.
	GO:0003968	RNA-directed 5'-3' RNA polymerase activity	Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1); uses an RNA template, i.e. the catalysis of RNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time.
	GO:0004197	cysteine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
	GO:0008234	cysteine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
	GO:0004386	helicase activity	Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0005216	ion channel activity	Enables the facilitated diffusion of an ion (by an energy-independent process) by passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism. May be either selective (it enables passage of a specific ion only) or non-selective (it enables passage of two or more ions of same charge but different size).
	GO:0017111	nucleoside-triphosphatase activity	Catalysis of the reaction: a nucleoside triphosphate + H2O = nucleoside diphosphate + phosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0016779	nucleotidyltransferase activity	Catalysis of the transfer of a nucleotidyl group to a reactant.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005198	structural molecule activity	The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0018144	RNA-protein covalent cross-linking	The formation of a covalent cross-link between RNA and a protein.
	GO:0034220	ion transmembrane transport	A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0039707	pore formation by virus in membrane of host cell	The aggregation, arrangement and bonding together of a set of components by a virus to form a pore complex in a membrane of a host organism.
	GO:0051259	protein oligomerization	The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers; protein oligomers may be composed of different or identical monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
	GO:0001172	transcription, RNA-templated	The cellular synthesis of RNA on a template of RNA.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0039694	viral RNA genome replication	The replication of a viral RNA genome.
	GO:0046718	viral entry into host cell	The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
	GO:0019062	virion attachment to host cell	The process by which a virion protein binds to molecules on the host cellular surface or host cell surface projection.
cellular component
	GO:0030430	host cell cytoplasm	The cytoplasm of a host cell.
	GO:0044161	host cell cytoplasmic vesicle	A vesicle formed of membrane or protein, found in the cytoplasm of a host cell.
	GO:0044162	host cell cytoplasmic vesicle membrane	The lipid bilayer surrounding a host cell cytoplasmic vesicle.
	GO:0033644	host cell membrane	Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0044385	integral to membrane of host cell	Penetrating at least one phospholipid bilayer of a membrane. May also refer to the state of being buried in the bilayer with no exposure outside the bilayer. When used to describe a protein, indicates that all or part of the peptide sequence is embedded in the membrane. Occurring in a host cell.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0019028	viral capsid	The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
	GO:0019012	virion	The complete fully infectious extracellular virus particle.

Chain D (Q91QV1_9ENTO | Q91QV1)

molecular function
	GO:0005198	structural molecule activity	The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
cellular component
	GO:0019028	viral capsid	The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
	GO:0019012	virion	The complete fully infectious extracellular virus particle.

Chain F (DAF_HUMAN | P08174)

molecular function
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0001618	virus receptor activity	Combining with a virus component and mediating entry of the virus into the cell.
biological process
	GO:0035743	CD4-positive, alpha-beta T cell cytokine production	Any process that contributes to cytokine production by a CD4-positive, alpha-beta T cell.
	GO:0006888	ER to Golgi vesicle-mediated transport	The directed movement of substances from the endoplasmic reticulum (ER) to the Golgi, mediated by COP II vesicles. Small COP II coated vesicles form from the ER and then fuse directly with the cis-Golgi. Larger structures are transported along microtubules to the cis-Golgi.
	GO:0006958	complement activation, classical pathway	Any process involved in the activation of any of the steps of the classical pathway of the complement cascade which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0045916	negative regulation of complement activation	Any process that stops, prevents, or reduces the frequency, rate or extent of complement activation.
	GO:2000516	positive regulation of CD4-positive, alpha-beta T cell activation	Any process that activates or increases the frequency, rate or extent of CD4-positive, alpha-beta T cell activation.
	GO:2000563	positive regulation of CD4-positive, alpha-beta T cell proliferation	Any process that activates or increases the frequency, rate or extent of CD4-positive, alpha-beta T cell proliferation.
	GO:0007204	positive regulation of cytosolic calcium ion concentration	Any process that increases the concentration of calcium ions in the cytosol.
	GO:0030449	regulation of complement activation	Any process that modulates the frequency, rate or extent of complement activation.
	GO:0031664	regulation of lipopolysaccharide-mediated signaling pathway	Any process that modulates the frequency, rate or extent of signaling in response to detection of lipopolysaccharide.
	GO:0045730	respiratory burst	A phase of elevated metabolic activity, during which oxygen consumption increases; this leads to the production, by an NADH dependent system, of hydrogen peroxide (H2O2), superoxide anions and hydroxyl radicals.
	GO:0046718	viral entry into host cell	The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:0031225	anchored component of membrane	The component of a membrane consisting of the gene products that are tethered to the membrane only by a covalently attached anchor, such as a lipid group that is embedded in the membrane. Gene products with peptide sequences that are embedded in the membrane are excluded from this grouping.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	The lipid bilayer surrounding any of the compartments of the endoplasmic reticulum (ER)-Golgi intermediate compartment system.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0045121	membrane raft	Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0030133	transport vesicle	Any of the vesicles of the constitutive secretory pathway, which carry cargo from the endoplasmic reticulum to the Golgi, between Golgi cisternae, from the Golgi to the ER (retrograde transport) or to destinations within or outside the cell.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		DAO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Asn F:238 - Asn F:239	[ RasMol ]
		Gln F:79 - Pro F:80	[ RasMol ]
		Glu F:18 - Gly F:19	[ RasMol ]
		Phe C:81 - Pro C:82	[ RasMol ]
		Pro F:99 - Gly F:100	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3iyp
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	DAF_HUMAN \| P08174
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	Q6W9E5_9ENTO \| Q6W9E5
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL
	Q91QV1_9ENTO \| Q91QV1
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL
	Q9QP24_9ENTO \| Q9QP24
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	DAF_HUMAN \| P08174
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	Q6W9E5_9ENTO \| Q6W9E5
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	Q91QV1_9ENTO \| Q91QV1
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	Q9QP24_9ENTO \| Q9QP24
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	DAF_HUMAN \| P08174	:	1h03 1h04 1h2p 1h2q 1m11 1nwv 1ojv 1ojw 1ojy 1ok1 1ok2 1ok3 1ok9 1uot 1upn 2c8i 2qzd 2qzf 2qzh 3j24 5foa
UniProtKB/TrEMBL
	Q6W9E5_9ENTO \| Q6W9E5	:	2x5i

(no "Related Entries Specified in the PDB File" available for 3IYP)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (8, 8)

Cis Peptide Bonds (5, 5)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (6, 6)

PROSITE Motifs (1, 4)

Exons (7, 7)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (61, 70)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File