Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE ECHOVIRUS 7
 
Authors :  P. Plevka, S. Hafenstein, Y. Zhang, V. D. Bowman, P. R. Chipman, C. M. Bat M. G. Rossmann
Date :  08 Feb 10  (Deposition) - 22 Dec 10  (Release) - 09 Mar 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.10
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B,C,D  (60x)
Keywords :  Virus, Capsid Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  P. Plevka, S. Hafenstein, K. G. Harris, J. O. Cifuente, Y. Zhang, V. D. Bowman, P. R. Chipman, C. M. Bator, F. Lin, M. E. Medof, M. G. Rossmann
Interaction Of Decay-Accelerating Factor With Echovirus 7.
J. Virol. V. 84 12665 2010
PubMed-ID: 20881044  |  Reference-DOI: 10.1128/JVI.00837-10

(-) Compounds

Molecule 1 - VP1
    ChainsA
    Organism ScientificHUMAN ECHOVIRUS 7
    Organism Taxid46018
    Other DetailsTHE ECHOVIRUS7 (WALLACE) WAS PURCHASED FROM THE AMERICAN TYPE CULTURE COLLECTION.
    StrainWALLACE
 
Molecule 2 - VP2
    ChainsB
    Organism ScientificHUMAN ECHOVIRUS 7
    Organism Taxid46018
    Other DetailsTHE ECHOVIRUS7 (WALLACE) WAS PURCHASED FROM THE AMERICAN TYPE CULTURE COLLECTION.
    StrainWALLACE
 
Molecule 3 - VP3
    ChainsC
    Organism ScientificHUMAN ECHOVIRUS 7
    Organism Taxid46018
    Other DetailsTHE ECHOVIRUS7 (WALLACE) WAS PURCHASED FROM THE AMERICAN TYPE CULTURE COLLECTION.
    StrainWALLACE
 
Molecule 4 - VP4
    ChainsD
    Organism ScientificHUMAN ECHOVIRUS 7
    Organism Taxid46018
    Other DetailsTHE ECHOVIRUS7 (WALLACE) WAS PURCHASED FROM THE AMERICAN TYPE CULTURE COLLECTION.
    StrainWALLACE

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (60x)ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric Unit (1, 1)
No.NameCountTypeFull Name
1DAO1Ligand/IonLAURIC ACID
Biological Unit 1 (1, 60)
No.NameCountTypeFull Name
1DAO60Ligand/IonLAURIC ACID

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREILE A:95 , PHE A:107 , MET A:117 , TYR A:146 , MET A:181 , ILE A:183 , ASN A:194 , TYR A:210 , MET A:216BINDING SITE FOR RESIDUE DAO A1289

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2X5I)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Phe B:81 -Pro B:82

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2X5I)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2X5I)

(-) Exons   (0, 0)

(no "Exon" information available for 2X5I)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:277
 aligned with Q6W9E5_9ENTO | Q6W9E5 from UniProtKB/TrEMBL  Length:2194

    Alignment length:277
                                   588       598       608       618       628       638       648       658       668       678       688       698       708       718       728       738       748       758       768       778       788       798       808       818       828       838       848       
         Q6W9E5_9ENTO   579 IARVADTVASGPSNSTSIPALTAVETGHTSQVEPSDTMQTRHVKNYHSRSESTVENFLSRSACVYIEEYYTKDQDNVNRYMSWTINARRMVQLRRKFELFTYMRFDMEITFVITSRQLPGTSIAQDMPPLTHQIMYIPPGGPVPNSVTDFAWQTSTNPSIFWTEGNAPPRMSIPFISIGNAYSNFYDGWSHFSQNGVYGYNALNNMGKLYARHVNKDTPYQMSSTIRVYFKPKHIRVWVPRPPRLSPYIKSSNVNFNPTNLTDERSSITYVPDTIRP 855
               SCOP domains d2x5ia_ A: automated matches                                                                                                                                                                                                                                                          SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....................eehhhhh.....hhhhh...............hhhhhhh..eeeeeeeee.........ee........hhhhhhhhh.eeeeeeeeeeeeeeeeee.............eeeeeee...........hhhhhh....eeeee......eeee........ee.....eee...eeee.hhhh....eeeeee........eeeeeeeeeeeeeeeeeee..................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2x5i A  11 IARVADTVASGPSNSTSIPALTAVETGHTSQVEPSDTMQTRHVKNYHSRSESTVENFLSRSACVYIEEYYTKDQDNVNRYMSWTINARRMVQLRRKFELFTYMRFDMEITFVITSRQLPGTSIAQDMPPLTHQIMYIPPGGPVPNSVTDFAWQTSTNPSIFWTEGNAPPRMSIPFISIGNAYSNFYDGWSHFSQNGVYGYNALNNMGKLYARHVNKDTPYQMSSTIRVYFKPKHIRVWVPRPPRLSPYIKSSNVNFNPTNLTDERSSITYVPDTIRP 287
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       

Chain B from PDB  Type:PROTEIN  Length:252
 aligned with Q6W9E5_9ENTO | Q6W9E5 from UniProtKB/TrEMBL  Length:2194

    Alignment length:252
                                    88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328  
         Q6W9E5_9ENTO    79 SDRVRSLTLGNSTITTQESANVVVGYGRWPEYLRDDEATAEDQPTQPDVATCRFYTLESVQWEKNSAGWWWKFPEALKDMGLFGQNMLYHYLGRAGYTIHVQCNASKFHQGCLLVVCVPEAEMGCSQTDKEVAAMNLTKGEAAHKFEPTKTNGEHTVQSIVCNAGMGVGVGNLTIYPHQWINLRTNNCATIVMPYVNSVPMDNMFRHYNFTLMVIPFAPLDYAAQASEYVPVTVTIAPMCAEYNGLRLAYQQ 330
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeee..eeeee......ee......................hhhhh...ee...eee......eeeeehhhhh.hhhhhhhhhheeeee...eeeee.......eeeeeeeeee.............hhhhhh.....ee...............hhhh....hhhhhhhh.eeeee.....eeeee.................eeeeeeeeeeee........eeeeeeee....eeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2x5i B   9 SDRVRSLTLGNSTITTQESANVVVGYGRWPEYLRDDEATAEDQPTQPDVATCRFYTLESVQWEKNSAGWWWKFPEALKDMGLFGQNMLYHYLGRAGYTIHVQCNASKFHQGCLLVVCVPEAEMGCSQTDKEVAAMNLTKGEAAHKFEPTKTNGEHTVQSIVCNAGMGVGVGNLTIYPHQWINLRTNNCATIVMPYVNSVPMDNMFRHYNFTLMVIPFAPLDYAAQASEYVPVTVTIAPMCAEYNGLRLAYQQ 260
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258  

Chain C from PDB  Type:PROTEIN  Length:238
 aligned with Q6W9E5_9ENTO | Q6W9E5 from UniProtKB/TrEMBL  Length:2194

    Alignment length:238
                                   340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560        
         Q6W9E5_9ENTO   331 GLPVLNTPGSNQFMTSDDFQSPSAMPQFDVTPHMDIPGEVHNLMEIAEVDSVVPVNNIKANLQSMDAYHIEVNTGNYQGEKIFAFQMQPGLESVFKRTLMGEILNYYAHWSGSIKLTFTFCGSAMATGKLLLAYSPPGADVPATRKQAMLGTHMIWDIGLQSSCVLCIPWISQTHYRLVQQDEYTSAGNVTCWYQTGIVVPPGTPNKCVVLCFASACNDFSVRMLRDTPFIGQTALLQ 568
               SCOP domains d2x5ic_ C: automated matches                                                                                                                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---------------------------Rhv-2x5iC01 C:28-198                                                                                                                                                       ---------------------------------------- Pfam domains (1)
           Pfam domains (2) ---------------------------Rhv-2x5iC02 C:28-198                                                                                                                                                       ---------------------------------------- Pfam domains (2)
           Pfam domains (3) ---------------------------Rhv-2x5iC03 C:28-198                                                                                                                                                       ---------------------------------------- Pfam domains (3)
         Sec.struct. author ......................................ee..hhhhhh..ee.....hhhhh.hhhhh..eee.........eeee...........hhhhhhhh...eee..eeeeeee........eeeeeee........hhhhhhh.eeeeee.....eeeeee........ee..........eeeeee............eeeeeeeeee....ee................ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2x5i C   1 GLPVLNTPGSNQFMTSDDFQSPSAMPQFDVTPHMDIPGEVHNLMEIAEVDSVVPVNNIKANLQSMDAYHIEVNTGNYQGEKIFAFQMQPGLESVFKRTLMGEILNYYAHWSGSIKLTFTFCGSAMATGKLLLAYSPPGADVPATRKQAMLGTHMIWDIGLQSSCVLCIPWISQTHYRLVQQDEYTSAGNVTCWYQTGIVVPPGTPNKCVVLCFASACNDFSVRMLRDTPFIGQTALLQ 238
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230        

Chain D from PDB  Type:PROTEIN  Length:61
 aligned with Q6W9E5_9ENTO | Q6W9E5 from UniProtKB/TrEMBL  Length:2194

    Alignment length:69
                                    10        20        30        40        50        60         
         Q6W9E5_9ENTO     1 MGAQVSTQKTGAHETGLNASGNSIIHYTNINYYKDAASNSANRQDFTQDPGKFTEPVKDIMIKTMPALN  69
               SCOP domains --------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------- CATH domains
               Pfam domains -Pico_P1A-2x5iD        01 D:2-69                                      Pfam domains
         Sec.struct. author ...eeee........--------..eeee.....hhhhh..........hhhhhh.............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------- Transcript
                 2x5i D   1 MGAQVSTQKTGAHET--------IIHYTNINYYKDAASNSANRQDFTQDPGKFTEPVKDIMIKTMPALN  69
                                    10    |    -   |    30        40        50        60         
                                         15       24                                             

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2X5I)

(-) Pfam Domains  (2, 4)

Asymmetric Unit
(-)
Family: Rhv (55)
1aRhv-2x5iC01C:28-198
1bRhv-2x5iC02C:28-198
1cRhv-2x5iC03C:28-198

(-) Gene Ontology  (36, 36)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (Q6W9E5_9ENTO | Q6W9E5)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0003724    RNA helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a RNA helix.
    GO:0003968    RNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1); uses an RNA template, i.e. the catalysis of RNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time.
    GO:0004197    cysteine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
    GO:0008234    cysteine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
    GO:0004386    helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0005216    ion channel activity    Enables the facilitated diffusion of an ion (by an energy-independent process) by passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism. May be either selective (it enables passage of a specific ion only) or non-selective (it enables passage of two or more ions of same charge but different size).
    GO:0017111    nucleoside-triphosphatase activity    Catalysis of the reaction: a nucleoside triphosphate + H2O = nucleoside diphosphate + phosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0018144    RNA-protein covalent cross-linking    The formation of a covalent cross-link between RNA and a protein.
    GO:0034220    ion transmembrane transport    A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0039707    pore formation by virus in membrane of host cell    The aggregation, arrangement and bonding together of a set of components by a virus to form a pore complex in a membrane of a host organism.
    GO:0051259    protein oligomerization    The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers; protein oligomers may be composed of different or identical monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0001172    transcription, RNA-templated    The cellular synthesis of RNA on a template of RNA.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0039694    viral RNA genome replication    The replication of a viral RNA genome.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
    GO:0019062    virion attachment to host cell    The process by which a virion protein binds to molecules on the host cellular surface or host cell surface projection.
cellular component
    GO:0030430    host cell cytoplasm    The cytoplasm of a host cell.
    GO:0044161    host cell cytoplasmic vesicle    A vesicle formed of membrane or protein, found in the cytoplasm of a host cell.
    GO:0044162    host cell cytoplasmic vesicle membrane    The lipid bilayer surrounding a host cell cytoplasmic vesicle.
    GO:0033644    host cell membrane    Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0044385    integral to membrane of host cell    Penetrating at least one phospholipid bilayer of a membrane. May also refer to the state of being buried in the bilayer with no exposure outside the bilayer. When used to describe a protein, indicates that all or part of the peptide sequence is embedded in the membrane. Occurring in a host cell.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0019028    viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    DAO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Phe B:81 - Pro B:82   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2x5i
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q6W9E5_9ENTO | Q6W9E5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q6W9E5_9ENTO | Q6W9E5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q6W9E5_9ENTO | Q6W9E53iyp

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2X5I)