3HVQ - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF A COMPLEX BETWEEN PROTEIN PHOSPHATASE 1 ALPHA (PP1) AND THE PP1 BINDING AND PDZ DOMAINS OF NEURABIN

Authors :   D. A. Critton, M. J. Ragusa, R. Page, W. Peti

Date :   16 Jun 09 (Deposition) - 23 Mar 10 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B,C,D  (1x)
Biol. Unit 2: A,C  (1x)
Biol. Unit 3: B,D  (1x)

Keywords :   Pp1, Neurabin, Serine/Threonine Phosphatase, Post Synaptic Density, Glutametergic Receptors, Carbohydrate Metabolism, Cell Cycle, Cell Division, Glycogen Metabolism, Hydrolase, Iron, Manganese, Metal- Binding, Phosphoprotein, Protein Phosphatase, Actin-Binding, Cell Junction, Cell Projection, Cytoskeleton, Developmental Protein, Differentiation, Neurogenesis, Nucleus, Synapse, Synaptosome, Hydrolase-Hydrolase Regulator Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. J. Ragusa, B. Dancheck, D. A. Critton, A. C. Nairn, R. Page, W. Peti
Spinophilin Directs Protein Phosphatase 1 Specificity By Blocking Substrate Binding Sites.
Nat. Struct. Mol. Biol. V. 17 459 2010
PubMed-ID: 20305656 | Reference-DOI: 10.1038/NSMB.1786

Molecule 1 - SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-ALPHA CATALYTIC SUBUNIT
	Chains	:	A, B
	EC Number	:	3.1.3.16
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	RP1B
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	CATALYTIC SUBUNIT
	Gene	:	PPP1A, PPP1CA
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	PP-1A

Molecule 2 - NEURABIN-1
	Chains	:	C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	RP1B
	Expression System Strain	:	BL21(DE3)RIL
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	PP1 BINDING AND PDZ DOMAINS
	Gene	:	PPP1R9A
	Organism Common	:	RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116
	Synonym	:	NEURABIN-I, NEURAL TISSUE-SPECIFIC F-ACTIN-BINDING PROTEIN I, PROTEIN PHOSPHATASE 1 REGULATORY SUBUNIT 9A, P180, PP1BP175

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B	C	D
Biological Unit 2 (1x)	:	A		C
Biological Unit 3 (1x)	:		B		D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 9)

No.	Name	Count	Type	Full Name
1	GOL	3	Ligand/Ion	GLYCEROL
2	MN	4	Ligand/Ion	MANGANESE (II) ION
3	PO4	2	Ligand/Ion	PHOSPHATE ION

Biological Unit 1 (2, 5)

No.	Name	Count	Type	Full Name
1	GOL	3	Ligand/Ion	GLYCEROL
2	MN	-1	Ligand/Ion	MANGANESE (II) ION
3	PO4	2	Ligand/Ion	PHOSPHATE ION

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	GOL	-1	Ligand/Ion	GLYCEROL
2	MN	-1	Ligand/Ion	MANGANESE (II) ION
3	PO4	1	Ligand/Ion	PHOSPHATE ION

Biological Unit 3 (2, 4)

No.	Name	Count	Type	Full Name
1	GOL	3	Ligand/Ion	GLYCEROL
2	MN	-1	Ligand/Ion	MANGANESE (II) ION
3	PO4	1	Ligand/Ion	PHOSPHATE ION

Asymmetric Unit (9, 9)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:64 , HIS A:66 , ASP A:92 , MN A:331 , PO4 A:332 , HOH A:333 , HOH A:335	BINDING SITE FOR RESIDUE MN A 1
2	AC2	SOFTWARE	MN A:1 , ASP A:92 , ASN A:124 , HIS A:173 , HIS A:248 , PO4 A:332 , HOH A:335	BINDING SITE FOR RESIDUE MN A 331
3	AC3	SOFTWARE	MN A:1 , HIS A:66 , ASP A:92 , ARG A:96 , ASN A:124 , HIS A:125 , ARG A:221 , HIS A:248 , MN A:331 , HOH A:333 , HOH A:335 , HOH A:507 , HOH A:510	BINDING SITE FOR RESIDUE PO4 A 332
4	AC4	SOFTWARE	ASP B:64 , HIS B:66 , ASP B:92 , MN B:332 , PO4 B:333 , HOH B:337 , HOH B:338	BINDING SITE FOR RESIDUE MN B 331
5	AC5	SOFTWARE	ASP B:92 , ASN B:124 , HIS B:173 , HIS B:248 , MN B:331 , PO4 B:333 , HOH B:338	BINDING SITE FOR RESIDUE MN B 332
6	AC6	SOFTWARE	HIS B:66 , ASP B:92 , ARG B:96 , ASN B:124 , HIS B:125 , ARG B:221 , HIS B:248 , TYR B:272 , MN B:331 , MN B:332 , HOH B:337 , HOH B:338 , HOH B:513 , HOH B:515 , HOH B:516	BINDING SITE FOR RESIDUE PO4 B 333
7	AC7	SOFTWARE	LYS A:26 , GLY B:14 , ARG B:15 , GLU B:18 , HOH B:336 , HOH B:341	BINDING SITE FOR RESIDUE GOL B 1
8	AC8	SOFTWARE	LYS B:260 , HOH B:432	BINDING SITE FOR RESIDUE GOL B 334
9	AC9	SOFTWARE	CYS B:127 , SER B:129 , ILE B:130 , VAL B:195 , ASP B:197 , TRP B:206 , HOH B:422	BINDING SITE FOR RESIDUE GOL B 335

(no "SS Bond" information available for 3HVQ)

Asymmetric Unit

No.	Residues
1	Ala A:57	-	Pro A:58
2	Pro A:82	-	Pro A:83
3	Arg A:191	-	Pro A:192
4	Ala B:57	-	Pro B:58
5	Pro B:82	-	Pro B:83
6	Arg B:191	-	Pro B:192

(no "SAP(SNP)/Variant" information available for 3HVQ)

Asymmetric Unit (2, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SER_THR_PHOSPHATASE	PS00125	Serine/threonine specific protein phosphatases signature.	PP1A_HUMAN	121-126	2	A:121-126 B:121-126
2	PDZ	PS50106	PDZ domain profile.	NEB1_RAT	505-593	1	C:505-592

Biological Unit 1 (2, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SER_THR_PHOSPHATASE	PS00125	Serine/threonine specific protein phosphatases signature.	PP1A_HUMAN	121-126	2	A:121-126 B:121-126
2	PDZ	PS50106	PDZ domain profile.	NEB1_RAT	505-593	1	C:505-592

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SER_THR_PHOSPHATASE	PS00125	Serine/threonine specific protein phosphatases signature.	PP1A_HUMAN	121-126	1	A:121-126 -
2	PDZ	PS50106	PDZ domain profile.	NEB1_RAT	505-593	1	C:505-592

Biological Unit 3 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SER_THR_PHOSPHATASE	PS00125	Serine/threonine specific protein phosphatases signature.	PP1A_HUMAN	121-126	1	- B:121-126
2	PDZ	PS50106	PDZ domain profile.	NEB1_RAT	505-593	0	-

Asymmetric Unit (14, 23)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSRNOT00000011756	1	ENSRNOE00000234466	chr4:29656850-29658247	1398	NEB1_RAT	1-466	466	2	C:436-466 D:435-466	31 32
1.2	ENSRNOT00000011756	2	ENSRNOE00000234458	chr4:29818404-29818536	133	NEB1_RAT	467-511	45	2	C:467-511 D:467-499	45 33
1.3	ENSRNOT00000011756	3	ENSRNOE00000234449	chr4:29827866-29827986	121	NEB1_RAT	511-551	41	1	C:511-551 -	41 -
1.4	ENSRNOT00000011756	4	ENSRNOE00000234443	chr4:29836250-29836274	25	NEB1_RAT	551-559	9	1	C:551-559 -	9 -
1.5	ENSRNOT00000011756	5	ENSRNOE00000234429	chr4:29836279-29836320	42	NEB1_RAT	560-573	14	1	C:560-573 -	14 -
1.6	ENSRNOT00000011756	6	ENSRNOE00000234423	chr4:29836325-29836356	32	NEB1_RAT	574-584	11	1	C:574-584 -	11 -
1.7	ENSRNOT00000011756	7	ENSRNOE00000234414	chr4:29845516-29845651	136	NEB1_RAT	584-629	46	1	C:584-592 -	9 -
1.8	ENSRNOT00000011756	8	ENSRNOE00000234405	chr4:29868210-29868365	156	NEB1_RAT	630-681	52	0	-	-
1.9	ENSRNOT00000011756	9	ENSRNOE00000234396	chr4:29880214-29880267	54	NEB1_RAT	682-699	18	0	-	-
1.10b	ENSRNOT00000011756	10b	ENSRNOE00000287107	chr4:29882803-29883032	230	NEB1_RAT	700-776	77	0	-	-
1.11	ENSRNOT00000011756	11	ENSRNOE00000234490	chr4:29884329-29884425	97	NEB1_RAT	776-808	33	0	-	-
1.12	ENSRNOT00000011756	12	ENSRNOE00000234485	chr4:29884519-29884690	172	NEB1_RAT	809-866	58	0	-	-
1.15	ENSRNOT00000011756	15	ENSRNOE00000233971	chr4:29902418-29902575	158	NEB1_RAT	866-918	53	0	-	-
1.16	ENSRNOT00000011756	16	ENSRNOE00000083456	chr4:29924526-29924645	120	NEB1_RAT	919-958	40	0	-	-
1.17	ENSRNOT00000011756	17	ENSRNOE00000233957	chr4:29925420-29925443	24	NEB1_RAT	959-966	8	0	-	-
1.18	ENSRNOT00000011756	18	ENSRNOE00000083487	chr4:29926495-29926677	183	NEB1_RAT	967-1027	61	0	-	-
1.19	ENSRNOT00000011756	19	ENSRNOE00000083535	chr4:29927942-29928142	201	NEB1_RAT	1028-1093	66	0	-	-

2.3a	ENST00000376745	3a	ENSE00001471548	chr11:67169402-67169199	204	PP1A_HUMAN	1-19	19	2	A:7-19 B:7-19	13 13
2.4d	ENST00000376745	4d	ENSE00001212206	chr11:67168670-67168539	132	PP1A_HUMAN	19-63	45	2	A:19-63 B:19-63	45 45
2.4f	ENST00000376745	4f	ENSE00001741927	chr11:67168390-67168160	231	PP1A_HUMAN	63-140	78	2	A:63-140 B:63-140	78 78
2.5a	ENST00000376745	5a	ENSE00001186176	chr11:67167136-67167032	105	PP1A_HUMAN	140-175	36	2	A:140-175 B:140-175	36 36
2.6a	ENST00000376745	6a	ENSE00001186169	chr11:67166634-67166411	224	PP1A_HUMAN	175-249	75	2	A:175-249 B:175-249	75 75
2.6d	ENST00000376745	6d	ENSE00001707059	chr11:67166327-67166193	135	PP1A_HUMAN	250-294	45	2	A:250-294 B:250-294	45 45
2.7c	ENST00000376745	7c	ENSE00002183271	chr11:67166116-67165672	445	PP1A_HUMAN	295-330	36	2	A:295-300 B:295-300	6 6

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:294
 aligned with PP1A_HUMAN | P62136 from UniProtKB/Swiss-Prot  Length:330

    Alignment length:294
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296    
           PP1A_HUMAN     7 LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD 300
               SCOP domains d3hvqa_ A: automated matches                                                                                                                                                                                                                                                                           SCOP domains
               CATH domains 3hvqA00 A:7-300  [code=3.60.21.10, no name defined]                                                                                                                                                                                                                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhh............hhhhhhhhhhhhhhhhhhh..eeee...eeee.....hhhhhhhhhhhhh......eee.........hhhhhhhhhhhhhhhh...eee......hhhhhh..hhhhhhhhhhhhhhhhhhhhhhh....eeee...eeee..........hhhhhh..........hhhhhhhhhee......eee......eeehhhhhhhhhhhhh..eeee........eeee....eeee....hhhhh....eeeeee....eeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------SER_TH------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 2 (1) Exon 2.3a    -------------------------------------------Exon 2.4f  PDB: A:63-140 UniProt: 63-140                                      ----------------------------------Exon 2.6a  PDB: A:175-249 UniProt: 175-249                                 Exon 2.6d  PDB: A:250-294 UniProt: 250-294   2.7c   Transcript 2 (1)
           Transcript 2 (2) ------------Exon 2.4d  PDB: A:19-63 UniProt: 19-63       ----------------------------------------------------------------------------Exon 2.5a  PDB: A:140-175           ----------------------------------------------------------------------------------------------------------------------------- Transcript 2 (2)
                 3hvq A   7 LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD 300
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296

Chain B from PDB  Type:PROTEIN  Length:294
 aligned with PP1A_HUMAN | P62136 from UniProtKB/Swiss-Prot  Length:330

    Alignment length:294
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296    
           PP1A_HUMAN     7 LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD 300
               SCOP domains d3hvqb_ B: automated matches                                                                                                                                                                                                                                                                           SCOP domains
               CATH domains 3hvqB00 B:7-300  [code=3.60.21.10, no name defined]                                                                                                                                                                                                                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhh............hhhhhhhhhhhhhhhhhhh..eeee...eeee.....hhhhhhhhhhhhh......eee.........hhhhhhhhhhhhhhhh...eee......hhhhhh..hhhhhhhhhhhhhhhhhhhhhhh....eeee...eee...........hhhhhh..........hhhhhhhhhee......eee......eeehhhhhhhhhhhhh..eeee........eeee....eeee....hhhhh....eeeeee....eeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------SER_TH------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 2 (1) Exon 2.3a    -------------------------------------------Exon 2.4f  PDB: B:63-140 UniProt: 63-140                                      ----------------------------------Exon 2.6a  PDB: B:175-249 UniProt: 175-249                                 Exon 2.6d  PDB: B:250-294 UniProt: 250-294   2.7c   Transcript 2 (1)
           Transcript 2 (2) ------------Exon 2.4d  PDB: B:19-63 UniProt: 19-63       ----------------------------------------------------------------------------Exon 2.5a  PDB: B:140-175           ----------------------------------------------------------------------------------------------------------------------------- Transcript 2 (2)
                 3hvq B   7 LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD 300
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296

Chain C from PDB  Type:PROTEIN  Length:157
 aligned with NEB1_RAT | O35867 from UniProtKB/Swiss-Prot  Length:1095

    Alignment length:157
                                   445       455       465       475       485       495       505       515       525       535       545       555       565       575       585       
             NEB1_RAT   436 PDMEYSEIVGLPQEEEIPANRKIKFSCAPIKVFNTYSNEDYDRRNDDVDPVAASAEYELEKRVEKLELFPVELEKDEDGLGISIIGMGVGADAGLEKLGIFVKTVTEGGAAQRDGRIQVNDQIVEVDGISLVGVTQNFAATVLRNTKGNVRFVIGRE 592
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee...............ee....eeeeee.............hhhhhhhhhhhhhhhh..eeeeeeee.......eeeeee...........eeeeeee...hhhhhhh......eeeee..ee....hhhhhhhhhhhh..eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------PDZ  PDB: C:505-592 UniProt: 505-593                                                     PROSITE
           Transcript 1 (1) Exon 1.1  PDB: C:436-466       Exon 1.2  PDB: C:467-511 UniProt: 467-511    ---------------------------------------Exon 1.4 Exon 1.5      Exon 1.6   -------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------Exon 1.3  PDB: C:511-551 UniProt: 511-551--------------------------------Exon 1.7  Transcript 1 (2)
                 3hvq C 436 PDMEYSEIVGLPQEEEIPANRKIKFSCAPIKVFNTYSNEDYDRRNDDVDPVAASAEYELEKRVEKLELFPVELEKDEDGLGISIIGMGVGADAGLEKLGIFVKTVTEGGAAQRDGRIQVNDQIVEVDGISLVGVTQNFAATVLRNTKGNVRFVIGRE 592
                                   445       455       465       475       485       495       505       515       525       535       545       555       565       575       585

Chain D from PDB  Type:PROTEIN  Length:65
 aligned with NEB1_RAT | O35867 from UniProtKB/Swiss-Prot  Length:1095

    Alignment length:65
                                   444       454       464       474       484       494     
             NEB1_RAT   435 QPDMEYSEIVGLPQEEEIPANRKIKFSCAPIKVFNTYSNEDYDRRNDDVDPVAASAEYELEKRVE 499
               SCOP domains ----------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee...............ee....eeeeee.............hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: D:435-466        Exon 1.2  PDB: D:467-499          Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------- Transcript 1 (2)
                 3hvq D 435 QPDMEYSEIVGLPQEEEIPANRKIKFSCAPIKVFNTYSNEDYDRRNDDVDPVAASAEYELEKRVE 499
                                   444       454       464       474       484       494

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Metallo-dependent phosphatases (115)

Superfamily: Metallo-dependent phosphatases (115)

Family: Protein serine/threonine phosphatase (50)

Protein domain: automated matches (6)

Human (Homo sapiens) [TaxId: 9606] (6)

1a	d3hvqa_	A:
1b	d3hvqb_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 4-Layer Sandwich (459)

Topology: Purple Acid Phosphatase; chain A, domain 2 (87)

Homologous Superfamily: [code=3.60.21.10, no name defined] (83)

Human (Homo sapiens) (36)

1a	3hvqA00	A:7-300
1b	3hvqB00	B:7-300

(no "Pfam Domain" information available for 3HVQ)

Asymmetric Unit(hide GO term definitions)

Chain A,B (PP1A_HUMAN | P62136)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016791	phosphatase activity	Catalysis of the hydrolysis of phosphoric monoesters, releasing inorganic phosphate.
	GO:0004721	phosphoprotein phosphatase activity	Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008157	protein phosphatase 1 binding	Interacting selectively and non-covalently with the enzyme protein phosphatase 1.
	GO:0004722	protein serine/threonine phosphatase activity	Catalysis of the reaction: protein serine phosphate + H2O = protein serine + phosphate, and protein threonine phosphate + H2O = protein threonine + phosphate.
	GO:0043021	ribonucleoprotein complex binding	Interacting selectively and non-covalently with any complex of RNA and protein.
biological process
	GO:1904886	beta-catenin destruction complex disassembly	The disaggregation of a beta-catenin destruction complex into its constituent components.
	GO:0048754	branching morphogenesis of an epithelial tube	The process in which the anatomical structures of branches in an epithelial tube are generated and organized. A tube is a long hollow cylinder.
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0032922	circadian regulation of gene expression	Any process that modulates the frequency, rate or extent of gene expression such that an expression pattern recurs with a regularity of approximately 24 hours.
	GO:0016311	dephosphorylation	The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
	GO:0043153	entrainment of circadian clock by photoperiod	The synchronization of a circadian rhythm to photoperiod, the intermittent cycle of light (day) and dark (night).
	GO:0005977	glycogen metabolic process	The chemical reactions and pathways involving glycogen, a polydisperse, highly branched glucan composed of chains of D-glucose residues in alpha-(1->4) glycosidic linkage, joined together by alpha-(1->6) glycosidic linkages.
	GO:0030324	lung development	The process whose specific outcome is the progression of the lung over time, from its formation to the mature structure. In all air-breathing vertebrates the lungs are developed from the ventral wall of the oesophagus as a pouch which divides into two sacs. In amphibians and many reptiles the lungs retain very nearly this primitive sac-like character, but in the higher forms the connection with the esophagus becomes elongated into the windpipe and the inner walls of the sacs become more and more divided, until, in the mammals, the air spaces become minutely divided into tubes ending in small air cells, in the walls of which the blood circulates in a fine network of capillaries. In mammals the lungs are more or less divided into lobes, and each lung occupies a separate cavity in the thorax.
	GO:0032091	negative regulation of protein binding	Any process that stops, prevents, or reduces the frequency, rate or extent of protein binding.
	GO:2001241	positive regulation of extrinsic apoptotic signaling pathway in absence of ligand	Any process that activates or increases the frequency, rate or extent of extrinsic apoptotic signaling pathway in absence of ligand.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
	GO:0060828	regulation of canonical Wnt signaling pathway	Any process that modulates the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
	GO:0042752	regulation of circadian rhythm	Any process that modulates the frequency, rate or extent of a circadian rhythm. A circadian rhythm is a biological process in an organism that recurs with a regularity of approximately 24 hours.
	GO:0005979	regulation of glycogen biosynthetic process	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of glycogen.
	GO:0005981	regulation of glycogen catabolic process	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of glycogen.
	GO:0036496	regulation of translational initiation by eIF2 alpha dephosphorylation	Any process that modulates the frequency, rate or extent of translation initiation in response to stress by the dephosphorylation of eIF2 alpha.
cellular component
	GO:0070688	MLL5-L complex	A protein complex that can methylate lysine-4 of histone H3 and plays an essential role in retinoic-acid-induced granulopoiesis. MLL5 is the catalytic methyltransferase subunit, and the complex also contains serine/threonine kinase 38 (STK38), protein phosphatase 1 catalytic subunits, the host cell factor-1 N-terminal subunit, beta-actin, and O-GlcNAc transferase; the human genes encoding the subunits are MLL5, STK38, PPP1CA, PPP1CB, PPP1CC, HCFC1, ACTB and OGT, respectively.
	GO:0072357	PTW/PP1 phosphatase complex	A protein serine/threonine phosphatase complex that contains a catalytic subunit (PPP1CA, PPP1CB or PPP1CC) and the regulatory subunits PPP1R10 (PNUTS), TOX4 and WDR82, and plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0043197	dendritic spine	A small, membranous protrusion from a dendrite that forms a postsynaptic compartment - typically receiving input from a single presynapse. They function as partially isolated biochemical and an electrical compartments. Spine morphology is variable including "thin", "stubby", "mushroom", and "branched", with a continuum of intermediate morphologies. They typically terminate in a bulb shape, linked to the dendritic shaft by a restriction. Spine remodeling is though to be involved in synaptic plasticity.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0042587	glycogen granule	Cytoplasmic bead-like structures of animal cells, visible by electron microscope. Each granule is a functional unit with the biosynthesis and catabolism of glycogen being catalyzed by enzymes bound to the granule surface.
	GO:0043005	neuron projection	A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
	GO:0043025	neuronal cell body	The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
	GO:0000784	nuclear chromosome, telomeric region	The terminal region of a linear nuclear chromosome that includes the telomeric DNA repeats and associated proteins.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043204	perikaryon	The portion of the cell soma (neuronal cell body) that excludes the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0000164	protein phosphatase type 1 complex	A protein complex that possesses magnesium-dependent protein serine/threonine phosphatase (AMD phosphatase) activity, and consists of a catalytic subunit and one or more regulatory subunits that dictates the phosphatase's substrate specificity, function, and activity.

Chain C,D (NEB1_RAT | O35867)

molecular function
	GO:0051020	GTPase binding	Interacting selectively and non-covalently with a GTPase, any enzyme that catalyzes the hydrolysis of GTP.
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0051015	actin filament binding	Interacting selectively and non-covalently with an actin filament, also known as F-actin, a helical filamentous polymer of globular G-actin subunits.
	GO:0044325	ion channel binding	Interacting selectively and non-covalently with one or more specific sites on an ion channel, a protein complex that spans a membrane and forms a water-filled channel across the phospholipid bilayer allowing selective ion transport down its electrochemical gradient.
	GO:0008022	protein C-terminus binding	Interacting selectively and non-covalently with a protein C-terminus, the end of any peptide chain at which the 1-carboxy function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
	GO:0008157	protein phosphatase 1 binding	Interacting selectively and non-covalently with the enzyme protein phosphatase 1.
biological process
	GO:0007015	actin filament organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments. Includes processes that control the spatial distribution of actin filaments, such as organizing filaments into meshworks, bundles, or other structures, as by cross-linking.
	GO:0007568	aging	A developmental process that is a deterioration and loss of function over time. Aging includes loss of functions such as resistance to disease, homeostasis, and fertility, as well as wear and tear. Aging includes cellular senescence, but is more inclusive. May precede death and may succeed developmental maturation (GO:0021700).
	GO:0019722	calcium-mediated signaling	Any intracellular signal transduction in which the signal is passed on within the cell via calcium ions.
	GO:0030154	cell differentiation	The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
	GO:0097237	cellular response to toxic substance	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a toxic stimulus.
	GO:0060079	excitatory postsynaptic potential	A process that leads to a temporary increase in postsynaptic potential due to the flow of positively charged ions into the postsynaptic cell. The flow of ions that causes an EPSP is an excitatory postsynaptic current (EPSC) and makes it easier for the neuron to fire an action potential.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:1900272	negative regulation of long-term synaptic potentiation	Any process that stops, prevents or reduces the frequency, rate or extent of long-term synaptic potentiation.
	GO:1904049	negative regulation of spontaneous neurotransmitter secretion	Any process that stops, prevents or reduces the frequency, rate or extent of spontaneous neurotransmitter secretion.
	GO:0051497	negative regulation of stress fiber assembly	Any process that stops, prevents, or reduces the frequency, rate or extent of the assembly a stress fiber, a bundle of microfilaments and other proteins found in fibroblasts.
	GO:0007399	nervous system development	The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
	GO:0048666	neuron development	The process whose specific outcome is the progression of a neuron over time, from initial commitment of the cell to a specific fate, to the fully functional differentiated cell.
	GO:0031175	neuron projection development	The process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
	GO:0060999	positive regulation of dendritic spine development	Any process that increases the rate, frequency, or extent of dendritic spine development, the process whose specific outcome is the progression of the dendritic spine over time, from its formation to the mature structure.
	GO:1900454	positive regulation of long term synaptic depression	Any process that activates or increases the frequency, rate or extent of long term synaptic depression.
	GO:0010976	positive regulation of neuron projection development	Any process that increases the rate, frequency or extent of neuron projection development. Neuron projection development is the process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
	GO:0045860	positive regulation of protein kinase activity	Any process that activates or increases the frequency, rate or extent of protein kinase activity.
	GO:0030833	regulation of actin filament polymerization	Any process that modulates the frequency, rate or extent of the assembly of actin filaments by the addition of actin monomers to a filament.
	GO:0061001	regulation of dendritic spine morphogenesis	Any process that modulates the rate, frequency, or extent of dendritic spine morphogenesis, the process in which the anatomical structures of a dendritic spine are generated and organized. A dendritic spine is a protrusion from a dendrite and a specialized subcellular compartment involved in synaptic transmission.
	GO:0051489	regulation of filopodium assembly	Any process that modulates the frequency, rate or extent of the assembly of a filopodium, a thin, stiff protrusion extended by the leading edge of a motile cell such as a crawling fibroblast or amoeba, or an axonal growth cone.
	GO:0051963	regulation of synapse assembly	Any process that modulates the frequency, rate or extent of synapse assembly, the aggregation, arrangement and bonding together of a set of components to form a synapse.
	GO:0051823	regulation of synapse structural plasticity	Any process that modulates the frequency, rate or extent of synapse structural plasticity. Synapse structural plasticity is a type of cytoskeletal remodeling; this remodeling is induced by stimuli that can lead to long term potentiation and it can be activity-dependent or -independent. Examples of cytoskeletal changes include the formation of new spines and increase in spine size; this can be accompanied by the insertion of greater numbers of glutamate (or other neurotransmitter) receptors into the post-synaptic membrane.
cellular component
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0030864	cortical actin cytoskeleton	The portion of the actin cytoskeleton, comprising filamentous actin and associated proteins, that lies just beneath the plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0030425	dendrite	A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
	GO:0043197	dendritic spine	A small, membranous protrusion from a dendrite that forms a postsynaptic compartment - typically receiving input from a single presynapse. They function as partially isolated biochemical and an electrical compartments. Spine morphology is variable including "thin", "stubby", "mushroom", and "branched", with a continuum of intermediate morphologies. They typically terminate in a bulb shape, linked to the dendritic shaft by a restriction. Spine remodeling is though to be involved in synaptic plasticity.
	GO:0044326	dendritic spine neck	Part of the dendritic spine that connects the dendritic shaft to the head of the dendritic spine.
	GO:0030175	filopodium	Thin, stiff, actin-based protrusion extended by the leading edge of a motile cell such as a crawling fibroblast or amoeba, or an axonal or dendritic growth cone, or a dendritic shaft.
	GO:0030426	growth cone	The migrating motile tip of a growing nerve cell axon or dendrite.
	GO:1990761	growth cone lamellipodium	A thin sheetlike process extended by the leading edge of an axonal or dendritic growth cone; contains a dense meshwork of actin filaments.
	GO:0030027	lamellipodium	A thin sheetlike process extended by the leading edge of a migrating cell or extending cell process; contains a dense meshwork of actin filaments.
	GO:0031594	neuromuscular junction	The junction between the axon of a motor neuron and a muscle fiber. In response to the arrival of action potentials, the presynaptic button releases molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane of the muscle fiber, leading to a change in post-synaptic potential.
	GO:0043005	neuron projection	A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
	GO:0043025	neuronal cell body	The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
	GO:0014069	postsynaptic density of dendrite	An electron dense network of proteins within and adjacent to the postsynaptic membrane of the dendrite of asymetric synapses. Its major components include neurotransmitter receptors and the proteins that spatially and functionally organize them such as anchoring and scaffolding molecules, signaling enzymes and cytoskeletal components.
	GO:0045202	synapse	The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:57 - Pro A:58	[ RasMol ]
		Ala B:57 - Pro B:58	[ RasMol ]
		Arg A:191 - Pro A:192	[ RasMol ]
		Arg B:191 - Pro B:192	[ RasMol ]
		Pro A:82 - Pro A:83	[ RasMol ]
		Pro B:82 - Pro B:83	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3hvq
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	NEB1_RAT \| O35867
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PP1A_HUMAN \| P62136
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.16
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	NEB1_RAT \| O35867
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	PP1A_HUMAN \| P62136
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	NEB1_RAT \| O35867	:	2fn5 2gle
	PP1A_HUMAN \| P62136	:	1fjm 3e7a 3e7b 3egg 3egh 3n5u 3v4y 4g9j 4mov 4moy 4mp0 4xpn 5ioh

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 9)

Sites (9, 9)

SS Bonds (0, 0)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 3)

Exons (14, 23)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (86, 94)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File