Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF AN ARRESTIN/CLATHRIN COMPLEX REVEALS A NOVEL CLATHRIN BINDING DOMAIN THAT MODULATES RECEPTOR TRAFFICKING
 
Authors :  D. S. Kang, R. C. Kern, M. A. Puthenveedu, M. Von Zastrow, J. C. Williams, J. L. Benovic
Date :  23 Feb 09  (Deposition) - 25 Aug 09  (Release) - 03 Nov 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.50
Chains :  Asym. Unit :  C,E,I,Z
Biol. Unit 1:  C  (1x)
Biol. Unit 2:  E  (1x)
Biol. Unit 3:  I  (1x)
Biol. Unit 4:  Z  (1x)
Keywords :  Clathrin, Arrestin, Endocytosis, Receptor Trafficking, Alternative Splicing, Phosphoprotein, Sensory Transduction, Acetylation, Coated Pit, Cytoplasmic Vesicle, Membrane (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. S. Kang, R. C. Kern, M. A. Puthenveedu, M. Von Zastrow, J. C. Williams, J. L. Benovic
Structure Of An Arrestin2-Clathrin Complex Reveals A Novel Clathrin Binding Domain That Modulates Receptor Trafficking
J. Biol. Chem. V. 284 29860 2009
PubMed-ID: 19710023  |  Reference-DOI: 10.1074/JBC.M109.023366
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - BETA-ARRESTIN-1
    ChainsC, E
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)PLYSS
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneARRB1
    Organism CommonBOVINE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    SynonymARRESTIN BETA-1
 
Molecule 2 - CLATHRIN HEAVY CHAIN 1
    ChainsI
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)PLYSS
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneCLTC
    Organism CommonBOVINE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
 
Molecule 3 - CLATHRIN
    ChainsZ
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)PLYSS
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentWD DOMAIN
    Organism CommonBOVINE
    Organism ScientificBOS TAURUS
    Organism Taxid9913

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit CEIZ
Biological Unit 1 (1x)C   
Biological Unit 2 (1x) E  
Biological Unit 3 (1x)  I 
Biological Unit 4 (1x)   Z

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3GD1)

(-) Sites  (0, 0)

(no "Site" information available for 3GD1)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3GD1)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Phe C:87 -Pro C:88
2Gly C:132 -Pro C:133
3Gln C:181 -Pro C:182
4Gly E:132 -Pro E:133

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3GD1)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ARRESTINSPS00295 Arrestins signature.ARRB1_BOVIN61-79
 
  2C:61-79
E:61-79
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ARRESTINSPS00295 Arrestins signature.ARRB1_BOVIN61-79
 
  1C:61-79
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ARRESTINSPS00295 Arrestins signature.ARRB1_BOVIN61-79
 
  1-
E:61-79
Biological Unit 3 (, 0)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ARRESTINSPS00295 Arrestins signature.ARRB1_BOVIN61-79
 
  0-
-
Biological Unit 4 (, 0)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ARRESTINSPS00295 Arrestins signature.ARRB1_BOVIN61-79
 
  0-
-

(-) Exons   (15, 29)

Asymmetric Unit (15, 29)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSBTAT000000272961ENSBTAE00000306942chr15:54119996-54119884113ARRB1_BOVIN1-771C:3-7
-
5
-
1.3bENSBTAT000000272963bENSBTAE00000306939chr15:54069390-5406936031ARRB1_BOVIN7-17112C:7-17
E:8-12
11
5
1.4ENSBTAT000000272964ENSBTAE00000222465chr15:54067563-5406750361ARRB1_BOVIN18-38212C:18-38
E:19-38 (gaps)
21
20
1.5ENSBTAT000000272965ENSBTAE00000222466chr15:54064217-5406417345ARRB1_BOVIN38-53162C:38-53
E:38-42
16
5
1.6ENSBTAT000000272966ENSBTAE00000222467chr15:54063453-54063257197ARRB1_BOVIN53-118662C:53-118 (gaps)
E:55-118 (gaps)
66
64
1.7ENSBTAT000000272967ENSBTAE00000222468chr15:54061953-5406189460ARRB1_BOVIN119-138202C:119-138
E:119-138 (gaps)
20
20
1.8ENSBTAT000000272968ENSBTAE00000222469chr15:54061081-5406101468ARRB1_BOVIN139-161232C:139-161
E:139-161 (gaps)
23
23
1.9ENSBTAT000000272969ENSBTAE00000389371chr15:54057878-54057743136ARRB1_BOVIN161-206462C:161-206 (gaps)
E:161-206 (gaps)
46
46
1.10ENSBTAT0000002729610ENSBTAE00000222471chr15:54056682-5405659885ARRB1_BOVIN207-235292C:207-235
E:207-235
29
29
1.11ENSBTAT0000002729611ENSBTAE00000306930chr15:54056171-5405609973ARRB1_BOVIN235-259252C:235-259
E:235-259
25
25
1.12ENSBTAT0000002729612ENSBTAE00000222473chr15:54055150-54055013138ARRB1_BOVIN259-305472C:259-305
E:259-305 (gaps)
47
47
1.13ENSBTAT0000002729613ENSBTAE00000231666chr15:54053859-5405377684ARRB1_BOVIN305-333292C:305-331
E:305-333
27
29
1.14ENSBTAT0000002729614ENSBTAE00000387453chr15:54051673-5405165024ARRB1_BOVIN333-34192C:339-341
E:333-341
3
9
1.15ENSBTAT0000002729615ENSBTAE00000222478chr15:54049468-5404939871ARRB1_BOVIN341-365252C:341-356
E:341-356
16
16
1.16ENSBTAT0000002729616ENSBTAE00000222479chr15:54048603-5404855252ARRB1_BOVIN365-382180--
1.17ENSBTAT0000002729617ENSBTAE00000222480chr15:54047228-54046525704ARRB1_BOVIN382-418372C:384-393
E:388-393
10
6

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain C from PDB  Type:PROTEIN  Length:345
 aligned with ARRB1_BOVIN | P17870 from UniProtKB/Swiss-Prot  Length:418

    Alignment length:391
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392 
          ARRB1_BOVIN     3 DKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPEHETPVDTNLIELDTNDDDIVFEDFAR 393
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---3gd1C01 C:6-176  [code=2.60.40.840, no name defined]                                                                                                                       --  3gd1C02 C:181-386  [code=2.60.40.640, no name defined]                                                                                                                                                        ------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee......eeee...eeee.......eeeeee.........eeeeeeeeeeee..-------...eeeeeeeeeeee...---....hhhhhhhhhh....eeeeee.........eeee....hhhh.eeeeeeeeeeee...........eeeeeeeeee......--....eee...........eeeee...eee....eeeeeeeee.....eeeeeeeeeeeeee.....eee..eeeeeee.......ee..eeeee............eee......................hhhh.eeeeeeeeeeeee..-------..eeeeeeeeeeee....---------------------------...eeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------ARRESTINS          -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.1  ----------Exon 1.4  PDB: C:18-3--------------Exon 1.6  PDB: C:53-118 (gaps) UniProt: 53-118                    Exon 1.7            Exon 1.8  PDB: C:139-16---------------------------------------------Exon 1.10  PDB: C:207-235    -----------------------Exon 1.12  PDB: C:259-305 UniProt: 259-305     ---------------------------Exon 1.14-----------------------Exon 1.16  PDB: - ----------- Transcript 1 (1)
           Transcript 1 (2) ----Exon 1.3b  --------------------Exon 1.5        -----------------------------------------------------------------------------------------------------------Exon 1.9  PDB: C:161-206 (gaps)               ----------------------------Exon 1.11  PDB: C:235-259---------------------------------------------Exon 1.13  PDB: C:305-331    -------Exon 1.15  PDB: C:341-356----------------Exon 1.17    Transcript 1 (2)
                 3gd1 C   3 DKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGR-------LTFRKDLFVANVQSFPPA---KKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERP--QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSR-------ASSDVAVELPFTLMHPKP---------------------------DDIVFEDFAR 393
                                    12        22        32        42        52        62  |      -|       82       | - |     102       112       122       132       142       152       162       172     | 182       192       202       212       222       232       242       252       262       272       282       292       302       312       322        |-      |342       352   |     -         -         - |     392 
                                                                                         65      73               90  94                                                                                 178  |                                                                                                                                                   331     339              356                         384         
                                                                                                                                                                                                            181                                                                                                                                                                                                                    

Chain E from PDB  Type:PROTEIN  Length:300
 aligned with ARRB1_BOVIN | P17870 from UniProtKB/Swiss-Prot  Length:418

    Alignment length:386
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387      
          ARRB1_BOVIN     8 VFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPEHETPVDTNLIELDTNDDDIVFEDFAR 393
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -----      ------------  ----------            ------------    ------------             --------------------------------------    ------------          -------------------  3gd1E02 E:181-356  [code=2.60.40.640, no name defined]                                                                                                                                                         ------ CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.------.eee....eee.--....eeeee.------------.eeeeeeee...----....eeeeee..-------------.................eeeee..........eee...----..eeeeeeeee.----------....eeee..eee......--...eeee.........eeeeeee....ee....eeeeeeeee....eeeeeeeeeeeeeee.....eeeeeeeeeeee...........eeeee.......--...eee......................hhhh.eeeeeeeeeeeeee....hhhh.eeeeeeeeee.ee....-------------------------------.ee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------ARRESTINS          -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) ----------Exon 1.4 [INCOMPLETE]--------------Exon 1.6  PDB: E:55-118 (gaps) UniProt: 53-118 [INCOMPLETE]       Exon 1.7            Exon 1.8               ---------------------------------------------Exon 1.10  PDB: E:207-235    -----------------------Exon 1.12  PDB: E:259-305 (gaps)               ---------------------------Exon 1.14-----------------------Exon 1.16  PDB: - ----------- Transcript 1 (1)
           Transcript 1 (2) Exon 1.3b --------------------Exon 1.5        -----------------------------------------------------------------------------------------------------------Exon 1.9  PDB: E:161-206 (gaps)               ----------------------------Exon 1.11  PDB: E:235-259---------------------------------------------Exon 1.13  PDB: E:305-333    -------Exon 1.15  PDB: E:341-356----------------Exon 1.17    Transcript 1 (2)
                 3gd1 E   8 VFKKA------TVYLGKRDFVDH--LVEPVDGVVL------------VTLTCAFRYGRE----LGLTFRKDLFVA-------------PLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGP----KACGVDYEVKAF----------KRNSVRLVIRKVQYAPERP--QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANN--KRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKP-------------------------------FEDFAR 393
                                |    - |      27  |  |  37    |    -       |57        |-   |    77    |    -        97       107       117       127     |   -|      147 |       -  |    167       177|  |   187       197       207       217       227       237       247       257       267       277   |  |287       297       307       317       327       337       347        |-         -         -         -|     
                               12     19         30 33       42           55         66   71         82            96                                  133  138        149        160               178  |                                                                                                 281  |                                                                     356                             388     
                                                                                                                                                                                                       181                                                                                                    284                                                                                                             

Chain I from PDB  Type:PROTEIN  Length:358
 aligned with CLH1_BOVIN | P49951 from UniProtKB/Swiss-Prot  Length:1675

    Alignment length:358
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352        
           CLH1_BOVIN     3 QILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA 360
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3gd1I00 I:3-360 Clathrin heavy-chain terminal domain                                                                                                                                                                                                                                                                                                                   CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeee.hhhh..........ee.....eeeeeee....eeeeeee........eee....eeee......eeeee..eeee.hhhhh...eeee......eeeeee..eeeee...eeeeee........eeee...........eeee.....eeeeeeeeee..eeeeeeeeee.......eee..eeeeeee........eeeeeeeee....eeeeeee.............eeee...........eeeeeee....eeeeee...eeeeee.....eeeeee.....eeeeeeehhhheeeeee...eeeeeee...hhhhhhh....hhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3gd1 I   3 QILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA 360
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352        

Chain Z from PDB  Type:PROTEIN  Length:8
                                        
               SCOP domains -------- SCOP domains
               CATH domains -------- CATH domains
               Pfam domains -------- Pfam domains
         Sec.struct. author ........ Sec.struct. author
                 SAPs(SNPs) -------- SAPs(SNPs)
                    PROSITE -------- PROSITE
                 Transcript -------- Transcript
                 3gd1 Z 371 TNLIELDA 378

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3GD1)

(-) CATH Domains  (3, 4)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3GD1)

(-) Gene Ontology  (59, 62)

Asymmetric Unit(hide GO term definitions)
Chain C,E   (ARRB1_BOVIN | P17870)
molecular function
    GO:0005096    GTPase activator activity    Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
    GO:0031701    angiotensin receptor binding    Interacting selectively and non-covalently with an angiotensin receptor.
    GO:0043027    cysteine-type endopeptidase inhibitor activity involved in apoptotic process    Stops, prevents or reduces the activity of a cysteine-type endopeptidase involved in the apoptotic process.
    GO:0005159    insulin-like growth factor receptor binding    Interacting selectively and non-covalently with the insulin-like growth factor receptor.
    GO:0031434    mitogen-activated protein kinase kinase binding    Interacting selectively and non-covalently with a mitogen-activated protein kinase kinase, any protein that can phosphorylate a MAP kinase.
    GO:0008134    transcription factor binding    Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
    GO:0044212    transcription regulatory region DNA binding    Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
    GO:0002031    G-protein coupled receptor internalization    The process that results in the uptake of a G-protein coupled receptor into an endocytic vesicle.
    GO:0032088    negative regulation of NF-kappaB transcription factor activity    Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of the transcription factor NF-kappaB.
    GO:0043154    negative regulation of cysteine-type endopeptidase activity involved in apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of a cysteine-type endopeptidase activity involved in the apoptotic process.
    GO:0032715    negative regulation of interleukin-6 production    Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-6 production.
    GO:0032717    negative regulation of interleukin-8 production    Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-8 production.
    GO:0031397    negative regulation of protein ubiquitination    Any process that stops, prevents, or reduces the frequency, rate or extent of the addition of ubiquitin groups to a protein.
    GO:0009968    negative regulation of signal transduction    Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction.
    GO:0007602    phototransduction    The sequence of reactions within a cell required to convert absorbed photons into a molecular signal.
    GO:0070374    positive regulation of ERK1 and ERK2 cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0043547    positive regulation of GTPase activity    Any process that activates or increases the activity of a GTPase.
    GO:0035025    positive regulation of Rho protein signal transduction    Any process that activates or increases the frequency, rate or extent of Rho protein signal transduction.
    GO:0090240    positive regulation of histone H4 acetylation    Any process that increases the rate, frequency, or extent of histone H4 acetylation, the modification of histone H4 by the addition of an acetyl group.
    GO:0035066    positive regulation of histone acetylation    Any process that activates or increases the frequency, rate or extent of the addition of an acetyl group to a histone protein.
    GO:0035774    positive regulation of insulin secretion involved in cellular response to glucose stimulus    Any process that increases the frequency, rate or extent of the regulated release of insulin that contributes to the response of a cell to glucose.
    GO:0033138    positive regulation of peptidyl-serine phosphorylation    Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-serine.
    GO:0032092    positive regulation of protein binding    Any process that activates or increases the frequency, rate or extent of protein binding.
    GO:0001934    positive regulation of protein phosphorylation    Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
    GO:0002092    positive regulation of receptor internalization    Any process that activates or increases the frequency, rate or extent of receptor internalization.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
    GO:0008277    regulation of G-protein coupled receptor protein signaling pathway    Any process that modulates the frequency, rate or extent of G-protein coupled receptor protein signaling pathway activity.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0043149    stress fiber assembly    The aggregation, arrangement and bonding together of a set of components to form a stress fiber. A stress fiber is a contractile actin filament bundle that consists of short actin filaments with alternating polarity.
    GO:0006366    transcription from RNA polymerase II promoter    The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0042995    cell projection    A prolongation or process extending from a cell, e.g. a flagellum or axon.
    GO:0000785    chromatin    The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome.
    GO:0005905    clathrin-coated pit    A part of the endomembrane system in the form of an invagination of a membrane upon which a clathrin coat forms, and that can be converted by vesicle budding into a clathrin-coated vesicle. Coated pits form on the plasma membrane, where they are involved in receptor-mediated selective transport of many proteins and other macromolecules across the cell membrane, in the trans-Golgi network, and on some endosomes.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0031410    cytoplasmic vesicle    A vesicle found in the cytoplasm of a cell.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0031143    pseudopodium    A temporary protrusion or retractile process of a cell, associated with flowing movements of the protoplasm, and serving for locomotion and feeding.

Chain I   (CLH1_BOVIN | P49951)
molecular function
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
    GO:0006886    intracellular protein transport    The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.
    GO:1900126    negative regulation of hyaluronan biosynthetic process    Any process that stops, prevents or reduces the frequency, rate or extent of hyaluronan biosynthetic process.
    GO:0016192    vesicle-mediated transport    A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane.
cellular component
    GO:0030132    clathrin coat of coated pit    The coat found on coated pits and the coated vesicles derived from coated pits; comprises clathrin and the AP-2 adaptor complex.
    GO:0030130    clathrin coat of trans-Golgi network vesicle    A clathrin coat found on a vesicle of the trans-Golgi network.
    GO:0005905    clathrin-coated pit    A part of the endomembrane system in the form of an invagination of a membrane upon which a clathrin coat forms, and that can be converted by vesicle budding into a clathrin-coated vesicle. Coated pits form on the plasma membrane, where they are involved in receptor-mediated selective transport of many proteins and other macromolecules across the cell membrane, in the trans-Golgi network, and on some endosomes.
    GO:0031410    cytoplasmic vesicle    A vesicle found in the cytoplasm of a cell.
    GO:0030659    cytoplasmic vesicle membrane    The lipid bilayer surrounding a cytoplasmic vesicle.
    GO:0042470    melanosome    A tissue-specific, membrane-bounded cytoplasmic organelle within which melanin pigments are synthesized and stored. Melanosomes are synthesized in melanocyte cells.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030117    membrane coat    Any of several different proteinaceous coats that can associate with membranes. Membrane coats include those formed by clathrin plus an adaptor complex, the COPI and COPII complexes, and possibly others. They are found associated with membranes on many vesicles as well as other membrane features such as pits and perhaps tubules.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3gd1)
 
  Sites
(no "Sites" information available for 3gd1)
 
  Cis Peptide Bonds
    Gln C:181 - Pro C:182   [ RasMol ]  
    Gly C:132 - Pro C:133   [ RasMol ]  
    Gly E:132 - Pro E:133   [ RasMol ]  
    Phe C:87 - Pro C:88   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3gd1
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ARRB1_BOVIN | P17870
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  CLH1_BOVIN | P49951
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ARRB1_BOVIN | P17870
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CLH1_BOVIN | P49951
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ARRB1_BOVIN | P178701g4m 1g4r 1jsy 1zsh 2wtr 3gc3
        CLH1_BOVIN | P499511b89 1utc 1xi4 1xi5 3gc3 3iyv 3lvg 3lvh 3qil 5m5r 5m5s 5m5t 5m5u 5m5v 5m61

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3GD1)