2WTR - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   FULL LENGTH ARRESTIN2

Authors :   H. G. Zhou, J. Standfuss, K. A. Watson, C. Krasel

Date :   21 Sep 09 (Deposition) - 29 Sep 09 (Release) - 29 Sep 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.90

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Signaling Protein, Sensory Transduction, G-Protein-Coupled Receptor Desensitization, Phosphoprotein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. G. Zhou, J. Standfuss, K. A. Watson, C. Krasel
A New Dimeric Crystal Form For Arrestin2
To Be Published
PubMed: search

Molecule 1 - BETA-ARRESTIN-1
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PTRC-HISB
	Expression System Strain	:	BL21(DE3)-LYSS
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Organism Common	:	CATTLE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913
	Synonym	:	ARRESTIN2, ARRESTIN BETA-1

Molecule 2 - BETA-ARRESTIN-1
	Chains	:	B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PTRC-HISB
	Expression System Strain	:	BL21(DE3)-LYSS
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Organism Common	:	CATTLE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913
	Synonym	:	ARRESTIN2, ARRESTIN BETA-1

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 4)

No.	Name	Count	Type	Full Name
1	BA	4	Ligand/Ion	BARIUM ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	BA	-1	Ligand/Ion	BARIUM ION

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	BA	-1	Ligand/Ion	BARIUM ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	THR B:186	BINDING SITE FOR RESIDUE BA B1402
2	AC2	SOFTWARE	THR A:186	BINDING SITE FOR RESIDUE BA A1399
3	AC3	SOFTWARE	THR A:273	BINDING SITE FOR RESIDUE BA A1398
4	AC4	SOFTWARE	THR B:273	BINDING SITE FOR RESIDUE BA B1401

(no "SS Bond" information available for 2WTR)

Asymmetric Unit

No.	Residues
1	Phe A:87	-	Pro A:88
2	Pro A:91	-	Glu A:92
3	Glu A:92	-	Asp A:93
4	Asp A:93	-	Lys A:94
5	Leu A:396	-	Lys A:397
6	Gly B:2	-	Asp B:3
7	Leu B:73	-	Thr B:74
8	Phe B:87	-	Pro B:88
9	Asp B:93	-	Lys B:94
10	Glu B:134	-	Asp B:135
11	Lys B:357	-	Glu B:358
12	Gln B:394	-	Arg B:395
13	Gly B:398	-	Met B:399

(no "SAP(SNP)/Variant" information available for 2WTR)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ARRESTINS	PS00295	Arrestins signature.	ARRB1_BOVIN	61-79	2	A:61-79 B:61-79

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ARRESTINS	PS00295	Arrestins signature.	ARRB1_BOVIN	61-79	1	A:61-79 -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ARRESTINS	PS00295	Arrestins signature.	ARRB1_BOVIN	61-79	1	- B:61-79

Asymmetric Unit (16, 31)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSBTAT00000027296	1	ENSBTAE00000306942	chr15:54119996-54119884	113	ARRB1_BOVIN	1-7	7	2	A:4-7 B:2-7	4 6
1.3b	ENSBTAT00000027296	3b	ENSBTAE00000306939	chr15:54069390-54069360	31	ARRB1_BOVIN	7-17	11	2	A:7-17 B:7-17	11 11
1.4	ENSBTAT00000027296	4	ENSBTAE00000222465	chr15:54067563-54067503	61	ARRB1_BOVIN	18-38	21	2	A:18-38 B:18-38	21 21
1.5	ENSBTAT00000027296	5	ENSBTAE00000222466	chr15:54064217-54064173	45	ARRB1_BOVIN	38-53	16	2	A:38-53 B:38-53	16 16
1.6	ENSBTAT00000027296	6	ENSBTAE00000222467	chr15:54063453-54063257	197	ARRB1_BOVIN	53-118	66	2	A:53-118 B:53-118 (gaps)	66 66
1.7	ENSBTAT00000027296	7	ENSBTAE00000222468	chr15:54061953-54061894	60	ARRB1_BOVIN	119-138	20	2	A:119-138 B:119-138	20 20
1.8	ENSBTAT00000027296	8	ENSBTAE00000222469	chr15:54061081-54061014	68	ARRB1_BOVIN	139-161	23	2	A:139-161 B:139-161	23 23
1.9	ENSBTAT00000027296	9	ENSBTAE00000389371	chr15:54057878-54057743	136	ARRB1_BOVIN	161-206	46	2	A:161-206 (gaps) B:161-206 (gaps)	46 46
1.10	ENSBTAT00000027296	10	ENSBTAE00000222471	chr15:54056682-54056598	85	ARRB1_BOVIN	207-235	29	2	A:207-235 B:207-235	29 29
1.11	ENSBTAT00000027296	11	ENSBTAE00000306930	chr15:54056171-54056099	73	ARRB1_BOVIN	235-259	25	2	A:235-259 B:235-259	25 25
1.12	ENSBTAT00000027296	12	ENSBTAE00000222473	chr15:54055150-54055013	138	ARRB1_BOVIN	259-305	47	2	A:259-305 B:259-305	47 47
1.13	ENSBTAT00000027296	13	ENSBTAE00000231666	chr15:54053859-54053776	84	ARRB1_BOVIN	305-333	29	2	A:305-330 B:305-331	26 27
1.14	ENSBTAT00000027296	14	ENSBTAE00000387453	chr15:54051673-54051650	24	ARRB1_BOVIN	333-341	9	2	A:341-341 B:339-341	1 3
1.15	ENSBTAT00000027296	15	ENSBTAE00000222478	chr15:54049468-54049398	71	ARRB1_BOVIN	341-365	25	2	A:341-357 B:341-360	17 20
1.16	ENSBTAT00000027296	16	ENSBTAE00000222479	chr15:54048603-54048552	52	ARRB1_BOVIN	365-382	18	1	- B:379-382	- 4
1.17	ENSBTAT00000027296	17	ENSBTAE00000222480	chr15:54047228-54046525	704	ARRB1_BOVIN	382-418	37	2	A:384-397 B:382-400	14 19

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:356
 aligned with ARRB1_BOVIN | P17870 from UniProtKB/Swiss-Prot  Length:418

    Alignment length:394
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393    
          ARRB1_BOVIN     4 KGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPEHETPVDTNLIELDTNDDDIVFEDFARQRLK 397
               SCOP domains d2wtra1 A:4-175 Arrestin                                                                                                                                                    d2  wtra2 A:176-397 Arrestin                                                                                                                                                                                                   SCOP domains
               CATH domains ---2wtrA01 A:7-176  [code=2.60.40.840, no name defined]                                                                                                                      -  2wtrA02 A:180-386  [code=2.60.40.640, no name defined]                                                                                                                                                         ----------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee......eeee....eee...........ee.hhhhhh..eeeeeeeeeeee...........eeeeeeeeeeeee..........hhhhhhhhhhh...ee..............ee.............eeeeeeeee............eeeee.eee.....--.....eeeee.......eeeee.....eee....eeeeeeeee.....eeeeeeeeeeeeee.....eeeeeeeeeeee........eeeeeeee.............ee............................eeeeeeeeeeee.----------.eeeeeee.eee.....--------------------------...eeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------ARRESTINS          ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) 1.1 ----------Exon 1.4  PDB: A:18-3--------------Exon 1.6  PDB: A:53-118 UniProt: 53-118                           Exon 1.7            Exon 1.8  PDB: A:139-16---------------------------------------------Exon 1.10  PDB: A:207-235    -----------------------Exon 1.12  PDB: A:259-305 UniProt: 259-305     ---------------------------Exon 1.14-----------------------Exon 1.16  PDB: - --------------- Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.3b  --------------------Exon 1.5        -----------------------------------------------------------------------------------------------------------Exon 1.9  PDB: A:161-206 (gaps)               ----------------------------Exon 1.11  PDB: A:235-259---------------------------------------------Exon 1.13  PDB: A:305-330    -------Exon 1.15  PDB: A:341-357----------------Exon 1.17        Transcript 1 (2)
                 2wtr A   4 KGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPER--PQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVS----------SDVAVELPFTLMHPKPK--------------------------DDIVFEDFARQRLK 397
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173   |  |183       193       203       213       223       233       243       253       263       273       283       293       303       313       323      |  -       343       353   |     -         -         -|      393    
                                                                                                                                                                                                       177  |                                                                                                                                                   330        341             357                        384             
                                                                                                                                                                                                          180

Chain B from PDB  Type:PROTEIN  Length:367
 aligned with ARRB1_BOVIN | P17870 from UniProtKB/Swiss-Prot  Length:418

    Alignment length:399
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391         
          ARRB1_BOVIN     2 GDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPEHETPVDTNLIELDTNDDDIVFEDFARQRLKGMK 400
               SCOP domains d2wtrb1 B:2-175 automated matches                                                                                                                                             d2  wtrb2 B:176-400 automated matches                                                                                                                                                                                             SCOP domains
               CATH domains -----2wtrB01 B:7-176  [code=2.60.40.840, no name defined]                                                                                                                      -  2wtrB02 B:180-386  [code=2.60.40.640, no name defined]                                                                                                                                                         -------------- CATH domains
           Pfam domains (1) ----------------Arrestin_N-2wtrB03 B:18-174                                                                                                                                  ---  -------------Arrestin_C-2wtrB01 B:193-356                                                                                                                                        ----                  ---------------------- Pfam domains (1)
           Pfam domains (2) ----------------Arrestin_N-2wtrB04 B:18-174                                                                                                                                  ---  -------------Arrestin_C-2wtrB02 B:193-356                                                                                                                                        ----                  ---------------------- Pfam domains (2)
         Sec.struct. author .....eeeeee......eeee...eeee......................eeeee.eeeeee..-----....eeeeeee..eeee..........hhhhhhhh......................ee.............eeeeeeeee...........eeeeeeeeee.....--.....eeeee.......eeeeeee...eee....eeeeeeeee.....eeeeeeeeeeeeee.....eeeeeeeeeeee.......eeeeeeeee...hhhhh.....ee...............................eeeeeeeee..-------..eeeeeeee.eee........------------------........eeee.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------ARRESTINS          --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.1   ----------Exon 1.4  PDB: B:18-3--------------Exon 1.6  PDB: B:53-118 (gaps) UniProt: 53-118                    Exon 1.7            Exon 1.8  PDB: B:139-16---------------------------------------------Exon 1.10  PDB: B:207-235    -----------------------Exon 1.12  PDB: B:259-305 UniProt: 259-305     ---------------------------Exon 1.14-----------------------Exon 1.16         ------------------ Transcript 1 (1)
           Transcript 1 (2) -----Exon 1.3b  --------------------Exon 1.5        -----------------------------------------------------------------------------------------------------------Exon 1.9  PDB: B:161-206 (gaps)               ----------------------------Exon 1.11  PDB: B:235-259---------------------------------------------Exon 1.13  PDB: B:305-331    -------Exon 1.15  PDB: B:341-360----------------Exon 1.17           Transcript 1 (2)
                 2wtr B   2 GDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGR-----VGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPER--PQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSR-------ASSDVAVELPFTLMHPKPKEEP------------------LDTNDDDIVFEDFARQRLKGMK 400
                                    11        21        31        41        51        61   |    71        81        91       101       111       121       131       141       151       161       171     | 181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351        |-         -       381       391         
                                                                                          65    71                                                                                                       177  |                                                                                                                                                    331     339                  360                379                     
                                                                                                                                                                                                            180

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Immunoglobulin-like beta-sandwich (7299)

Superfamily: E set domains (509)

Family: Arrestin/Vps26-like (13)

Protein domain: Arrestin (9)

Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913] (6)

1a	d2wtra1	A:4-175
1b	d2wtra2	A:176-397

Protein domain: automated matches (4)

Cow (Bos taurus) [TaxId: 9913] (4)

d2wtrb1

B:2-175

Family: automated matches (93)

Protein domain: automated matches (93)

Cow (Bos taurus) [TaxId: 9913] (2)

d2wtrb2

B:176-400

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Immunoglobulin-like (3897)

Homologous Superfamily: [code=2.60.40.640, no name defined] (10)

Cattle (Bos taurus) (7)

1a	2wtrB02	B:180-386
1b	2wtrA02	A:180-386

Homologous Superfamily: [code=2.60.40.840, no name defined] (10)

Cattle (Bos taurus) (7)

2a	2wtrA01	A:7-176
2b	2wtrB01	B:7-176

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Arrestin_N-like (9)

Family: Arrestin_C (5)

Bos taurus (Bovine) (4)

1a	Arrestin_C-2wtrB01	B:193-356
1b	Arrestin_C-2wtrB02	B:193-356

Family: Arrestin_N (5)

Bos taurus (Bovine) (4)

2a	Arrestin_N-2wtrB03	B:18-174
2b	Arrestin_N-2wtrB04	B:18-174

Asymmetric Unit(hide GO term definitions)

Chain A,B (ARRB1_BOVIN | P17870)

molecular function
	GO:0005096	GTPase activator activity	Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
	GO:0031701	angiotensin receptor binding	Interacting selectively and non-covalently with an angiotensin receptor.
	GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	Stops, prevents or reduces the activity of a cysteine-type endopeptidase involved in the apoptotic process.
	GO:0005159	insulin-like growth factor receptor binding	Interacting selectively and non-covalently with the insulin-like growth factor receptor.
	GO:0031434	mitogen-activated protein kinase kinase binding	Interacting selectively and non-covalently with a mitogen-activated protein kinase kinase, any protein that can phosphorylate a MAP kinase.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0044212	transcription regulatory region DNA binding	Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
	GO:0031625	ubiquitin protein ligase binding	Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
	GO:0002031	G-protein coupled receptor internalization	The process that results in the uptake of a G-protein coupled receptor into an endocytic vesicle.
	GO:0032088	negative regulation of NF-kappaB transcription factor activity	Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of the transcription factor NF-kappaB.
	GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of a cysteine-type endopeptidase activity involved in the apoptotic process.
	GO:0032715	negative regulation of interleukin-6 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-6 production.
	GO:0032717	negative regulation of interleukin-8 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-8 production.
	GO:0031397	negative regulation of protein ubiquitination	Any process that stops, prevents, or reduces the frequency, rate or extent of the addition of ubiquitin groups to a protein.
	GO:0009968	negative regulation of signal transduction	Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction.
	GO:0007602	phototransduction	The sequence of reactions within a cell required to convert absorbed photons into a molecular signal.
	GO:0070374	positive regulation of ERK1 and ERK2 cascade	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0035025	positive regulation of Rho protein signal transduction	Any process that activates or increases the frequency, rate or extent of Rho protein signal transduction.
	GO:0090240	positive regulation of histone H4 acetylation	Any process that increases the rate, frequency, or extent of histone H4 acetylation, the modification of histone H4 by the addition of an acetyl group.
	GO:0035066	positive regulation of histone acetylation	Any process that activates or increases the frequency, rate or extent of the addition of an acetyl group to a histone protein.
	GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	Any process that increases the frequency, rate or extent of the regulated release of insulin that contributes to the response of a cell to glucose.
	GO:0033138	positive regulation of peptidyl-serine phosphorylation	Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-serine.
	GO:0032092	positive regulation of protein binding	Any process that activates or increases the frequency, rate or extent of protein binding.
	GO:0001934	positive regulation of protein phosphorylation	Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
	GO:0002092	positive regulation of receptor internalization	Any process that activates or increases the frequency, rate or extent of receptor internalization.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0016567	protein ubiquitination	The process in which one or more ubiquitin groups are added to a protein.
	GO:0008277	regulation of G-protein coupled receptor protein signaling pathway	Any process that modulates the frequency, rate or extent of G-protein coupled receptor protein signaling pathway activity.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0043149	stress fiber assembly	The aggregation, arrangement and bonding together of a set of components to form a stress fiber. A stress fiber is a contractile actin filament bundle that consists of short actin filaments with alternating polarity.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0000785	chromatin	The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome.
	GO:0005905	clathrin-coated pit	A part of the endomembrane system in the form of an invagination of a membrane upon which a clathrin coat forms, and that can be converted by vesicle budding into a clathrin-coated vesicle. Coated pits form on the plasma membrane, where they are involved in receptor-mediated selective transport of many proteins and other macromolecules across the cell membrane, in the trans-Golgi network, and on some endosomes.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0031410	cytoplasmic vesicle	A vesicle found in the cytoplasm of a cell.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0031143	pseudopodium	A temporary protrusion or retractile process of a cell, associated with flowing movements of the protoplasm, and serving for locomotion and feeding.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		BA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Asp A:93 - Lys A:94	[ RasMol ]
		Asp B:93 - Lys B:94	[ RasMol ]
		Gln B:394 - Arg B:395	[ RasMol ]
		Glu A:92 - Asp A:93	[ RasMol ]
		Glu B:134 - Asp B:135	[ RasMol ]
		Gly B:2 - Asp B:3	[ RasMol ]
		Gly B:398 - Met B:399	[ RasMol ]
		Leu A:396 - Lys A:397	[ RasMol ]
		Leu B:73 - Thr B:74	[ RasMol ]
		Lys B:357 - Glu B:358	[ RasMol ]
		Phe A:87 - Pro A:88	[ RasMol ]
		Phe B:87 - Pro B:88	[ RasMol ]
		Pro A:91 - Glu A:92	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2wtr
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ARRB1_BOVIN \| P17870
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ARRB1_BOVIN \| P17870
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ARRB1_BOVIN \| P17870	:	1g4m 1g4r 1jsy 1zsh 3gc3 3gd1

1g4m	CRYSTAL STRUCTURE OF BOVINE BETA-ARRESTIN 1
1g4r	CRYSTAL STRUCTURE OF BOVINE BETA-ARRESTIN 1
1jsy	CRYSTAL STRUCTURE OF BOVINE ARRESTIN-2
1zsh	CRYSTAL STRUCTURE OF BOVINE ARRESTIN-2 IN COMPLEX WITHINOSITOL HEXAKISPHOSPHATE (IP6)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (13, 13)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (16, 31)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 4)

CATH Domains (2, 4)

Pfam Domains (2, 4)

Gene Ontology (49, 49)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File