3C7X - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   HEMOPEXIN-LIKE DOMAIN OF MATRIX METALLOPROTEINASE 14

Authors :   A. Tochowicz, Y. Itoh, K. Maskos, W. Bode, P. Goettig

Date :   08 Feb 08 (Deposition) - 10 Feb 09 (Release) - 26 Dec 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.70

Chains :   Asym. Unit : A
Biol. Unit 1: A  (1x)
Biol. Unit 2: A  (2x)
Biol. Unit 3: A  (2x)

Keywords :   Membrane Protein Interaction, Pro-Mmp-2, Timp-2, Metastasis, Cleavage On Pair Of Basic Residues, Hydrolase, Metal-Binding, Metalloprotease, Protease, Transmembrane, Zymogen (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. Tochowicz, P. Goettig, R. Evans, R. Visse, Y. Shitomi, R. Palmisano N. Ito, K. Richter, K. Maskos, D. Franke, D. Svergun, H. Nagase, W. Bode Y. Itoh
The Dimer Interface Of The Membrane Type 1 Matrix Metalloproteinase Hemopexin Domain: Crystal Structure And Biological Functions
J. Biol. Chem. V. 286 7587 2011
PubMed-ID: 21193411 | Reference-DOI: 10.1074/JBC.M110.178434

Molecule 1 - MATRIX METALLOPROTEINASE-14
	Chains	:	A
	EC Number	:	3.4.24.80
	Engineered	:	YES
	Expression System	:	HOMO SAPIENS
	Expression System Strain	:	HEK 293 CELLS
	Expression System Taxid	:	9606
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 316-511
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	HEMOPEXIN 14 DOMAIN, MMP-14, MEMBRANE-TYPE MATRIX METALLOPROTEINASE 1, MT-MMP 1, MTMMP1, MEMBRANE-TYPE-1 MATRIX, METALLOPROTEINASE, MT1-MMP, MT1MMP, MMP- X1

		1
Asymmetric Unit	:	A
Biological Unit 1 (1x)	:	A
Biological Unit 2 (2x)	:	A
Biological Unit 3 (2x)	:	A

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 2)

No.	Name	Count	Type	Full Name
1	CL	1	Ligand/Ion	CHLORIDE ION
2	NA	1	Ligand/Ion	SODIUM ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	CL	-1	Ligand/Ion	CHLORIDE ION
2	NA	-1	Ligand/Ion	SODIUM ION

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	CL	-1	Ligand/Ion	CHLORIDE ION
2	NA	-1	Ligand/Ion	SODIUM ION

Biological Unit 3 (0, 0)

No.	Name	Count	Type	Full Name
1	CL	-1	Ligand/Ion	CHLORIDE ION
2	NA	-1	Ligand/Ion	SODIUM ION

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HOH A:56 , ASN A:369 , THR A:370 , ASP A:416 , ARG A:464	BINDING SITE FOR RESIDUE NA A 1001
2	AC2	SOFTWARE	HOH A:19 , THR A:325 , ALA A:327 , THR A:370 , ALA A:371	BINDING SITE FOR RESIDUE CL A 1002

Asymmetric Unit

No.	Residues
1	A:319	-	A:508

Asymmetric Unit

No.	Residues
1	Tyr A:353	-	Pro A:354
2	Tyr A:399	-	Pro A:400
3	Tyr A:449	-	Pro A:450
4	Tyr A:497	-	Pro A:498

Asymmetric Unit (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_021035	M	355	I	MMP14_HUMAN	Polymorphism	17880989	A	M	355	I
2	UniProt	VAR_031267	R	431	H	MMP14_HUMAN	Polymorphism	3751489	A	R	431	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_021035	M	355	I	MMP14_HUMAN	Polymorphism	17880989	A	M	355	I
2	UniProt	VAR_031267	R	431	H	MMP14_HUMAN	Polymorphism	3751489	A	R	431	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_021035	M	355	I	MMP14_HUMAN	Polymorphism	17880989	A	M	355	I
2	UniProt	VAR_031267	R	431	H	MMP14_HUMAN	Polymorphism	3751489	A	R	431	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_021035	M	355	I	MMP14_HUMAN	Polymorphism	17880989	A	M	355	I
2	UniProt	VAR_031267	R	431	H	MMP14_HUMAN	Polymorphism	3751489	A	R	431	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 5)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HEMOPEXIN_2	PS51642	Hemopexin repeat profile.	MMP14_HUMAN	316-364 365-410 412-460 461-508	4	A:316-364 A:365-410 A:412-460 A:461-508
2	HEMOPEXIN	PS00024	Hemopexin domain signature.	MMP14_HUMAN	357-372	1	A:357-372

Biological Unit 1 (2, 5)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HEMOPEXIN_2	PS51642	Hemopexin repeat profile.	MMP14_HUMAN	316-364 365-410 412-460 461-508	4	A:316-364 A:365-410 A:412-460 A:461-508
2	HEMOPEXIN	PS00024	Hemopexin domain signature.	MMP14_HUMAN	357-372	1	A:357-372

Biological Unit 2 (2, 10)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HEMOPEXIN_2	PS51642	Hemopexin repeat profile.	MMP14_HUMAN	316-364 365-410 412-460 461-508	8	A:316-364 A:365-410 A:412-460 A:461-508
2	HEMOPEXIN	PS00024	Hemopexin domain signature.	MMP14_HUMAN	357-372	2	A:357-372

Biological Unit 3 (2, 10)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HEMOPEXIN_2	PS51642	Hemopexin repeat profile.	MMP14_HUMAN	316-364 365-410 412-460 461-508	8	A:316-364 A:365-410 A:412-460 A:461-508
2	HEMOPEXIN	PS00024	Hemopexin domain signature.	MMP14_HUMAN	357-372	2	A:357-372

Asymmetric Unit (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000311852	1	ENSE00001417791	chr14:23305772-23306134	363	MMP14_HUMAN	1-36	36	0	-	-
1.2	ENST00000311852	2	ENSE00001031343	chr14:23310700-23310848	149	MMP14_HUMAN	37-86	50	0	-	-
1.3	ENST00000311852	3	ENSE00001031341	chr14:23311122-23311244	123	MMP14_HUMAN	86-127	42	0	-	-
1.4	ENST00000311852	4	ENSE00001031346	chr14:23311619-23311926	308	MMP14_HUMAN	127-230	104	0	-	-
1.5	ENST00000311852	5	ENSE00001031364	chr14:23312466-23312627	162	MMP14_HUMAN	230-284	55	0	-	-
1.6	ENST00000311852	6	ENSE00001198262	chr14:23312919-23313079	161	MMP14_HUMAN	284-337	54	1	A:316-337	22
1.7	ENST00000311852	7	ENSE00001031362	chr14:23313580-23313718	139	MMP14_HUMAN	338-384	47	1	A:338-384	47
1.8	ENST00000311852	8	ENSE00001031361	chr14:23313839-23313989	151	MMP14_HUMAN	384-434	51	1	A:384-434	51
1.9	ENST00000311852	9	ENSE00001031354	chr14:23314460-23314575	116	MMP14_HUMAN	434-473	40	1	A:434-473	40
1.10	ENST00000311852	10	ENSE00001431522	chr14:23314917-23316970	2054	MMP14_HUMAN	473-582	110	1	A:473-511	39

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:196
 aligned with MMP14_HUMAN | P50281 from UniProtKB/Swiss-Prot  Length:582

    Alignment length:196
                                   325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505      
          MMP14_HUMAN   316 PNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSG 511
               SCOP domains d3c7xa_ A: automated matches                                                                                                                                                                         SCOP domains
               CATH domains 3c7xA00 A:316-511 Hemopexin                                                                                                                                                                          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh...eeeee..eeeeee..eeeeee..ee.....eehhhhh........eeee.....eeeee..eeeeee..ee.....ee.hhh..........eeee......eeeee..eeeeee....ee.....ee.hhh........eeee.....eeeeee..eeeeee....ee.....eehhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------I---------------------------------------------------------------------------H-------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) HEMOPEXIN_2  PDB: A:316-364 UniProt: 316-364     HEMOPEXIN_2  PDB: A:365-410 UniProt: 365-410  -HEMOPEXIN_2  PDB: A:412-460 UniProt: 412-460     HEMOPEXIN_2  PDB: A:461-508 UniProt: 461-508    --- PROSITE (1)
                PROSITE (2) -----------------------------------------HEMOPEXIN       ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.6 [INCOMPLETE] Exon 1.7  PDB: A:338-384 UniProt: 338-384      ----------------------------------------------------------------------------------------Exon 1.10  PDB: A:473-511 [INCOMPLETE]  Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------Exon 1.8  PDB: A:384-434 UniProt: 384-434          ----------------------------------------------------------------------------- Transcript 1 (2)
           Transcript 1 (3) ----------------------------------------------------------------------------------------------------------------------Exon 1.9  PDB: A:434-473                -------------------------------------- Transcript 1 (3)
                 3c7x A 316 PNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSG 511
                                   325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: 4-bladed beta-propeller (15)

Superfamily: Hemopexin-like domain (15)

Family: automated matches (3)

Protein domain: automated matches (3)

Human (Homo sapiens) [TaxId: 9606] (3)

d3c7xa_

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: 4 Propellor (14)

Topology: Hemopexin (14)

Homologous Superfamily: Hemopexin (14)

Human (Homo sapiens) (10)

3c7xA00

A:316-511

(no "Pfam Domain" information available for 3C7X)

Asymmetric Unit(hide GO term definitions)

Chain A (MMP14_HUMAN | P50281)

molecular function
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0005178	integrin binding	Interacting selectively and non-covalently with an integrin.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004222	metalloendopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
	GO:0008237	metallopeptidase activity	Catalysis of the hydrolysis of peptide bonds by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
	GO:0016504	peptidase activator activity	Binds to and increases the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0001525	angiogenesis	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
	GO:0043615	astrocyte cell migration	The orderly movement of an astrocyte, a class of large neuroglial (macroglial) cells in the central nervous system, the largest and most numerous neuroglial cells in the brain and spinal cord.
	GO:0060348	bone development	The process whose specific outcome is the progression of bone over time, from its formation to the mature structure. Bone is the hard skeletal connective tissue consisting of both mineral and cellular components.
	GO:0048754	branching morphogenesis of an epithelial tube	The process in which the anatomical structures of branches in an epithelial tube are generated and organized. A tube is a long hollow cylinder.
	GO:0016477	cell migration	The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
	GO:0035988	chondrocyte proliferation	The multiplication or reproduction of chondrocytes by cell division, resulting in the expansion of their population. A chondrocyte is a polymorphic cell that forms cartilage.
	GO:0030574	collagen catabolic process	The proteolytic chemical reactions and pathways resulting in the breakdown of collagen in the extracellular matrix, usually carried out by proteases secreted by nearby cells.
	GO:0097094	craniofacial suture morphogenesis	The process in which any suture between cranial and/or facial bones is generated and organized.
	GO:0048701	embryonic cranial skeleton morphogenesis	The process in which the anatomical structures of the cranial skeleton are generated and organized during the embryonic phase.
	GO:0001958	endochondral ossification	Replacement ossification wherein bone tissue replaces cartilage.
	GO:0035987	endodermal cell differentiation	The process in which a relatively unspecialized cell acquires the specialized features of an endoderm cell, a cell of the inner of the three germ layers of the embryo.
	GO:0001935	endothelial cell proliferation	The multiplication or reproduction of endothelial cells, resulting in the expansion of a cell population. Endothelial cells are thin flattened cells which line the inside surfaces of body cavities, blood vessels, and lymph vessels, making up the endothelium.
	GO:0022617	extracellular matrix disassembly	A process that results in the breakdown of the extracellular matrix.
	GO:0030324	lung development	The process whose specific outcome is the progression of the lung over time, from its formation to the mature structure. In all air-breathing vertebrates the lungs are developed from the ventral wall of the oesophagus as a pouch which divides into two sacs. In amphibians and many reptiles the lungs retain very nearly this primitive sac-like character, but in the higher forms the connection with the esophagus becomes elongated into the windpipe and the inner walls of the sacs become more and more divided, until, in the mammals, the air spaces become minutely divided into tubes ending in small air cells, in the walls of which the blood circulates in a fine network of capillaries. In mammals the lungs are more or less divided into lobes, and each lung occupies a separate cavity in the thorax.
	GO:0008584	male gonad development	The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
	GO:0045746	negative regulation of Notch signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of the Notch signaling pathway.
	GO:0051895	negative regulation of focal adhesion assembly	Any process that stops, prevents, or reduces the frequency, rate or extent of focal adhesion assembly, the establishment and maturation of focal adhesions.
	GO:0001503	ossification	The formation of bone or of a bony substance, or the conversion of fibrous tissue or of cartilage into bone or a bony substance.
	GO:0001541	ovarian follicle development	The process whose specific outcome is the progression of the ovarian follicle over time, from its formation to the mature structure.
	GO:0045579	positive regulation of B cell differentiation	Any process that activates or increases the frequency, rate or extent of B cell differentiation.
	GO:0030307	positive regulation of cell growth	Any process that activates or increases the frequency, rate, extent or direction of cell growth.
	GO:0030335	positive regulation of cell migration	Any process that activates or increases the frequency, rate or extent of cell migration.
	GO:0010831	positive regulation of myotube differentiation	Any process that activates, maintains or increases the frequency, rate or extent of myotube differentiation. Myotube differentiation is the process in which a relatively unspecialized cell acquires specialized features of a myotube cell. Myotubes are multinucleated cells that are formed when proliferating myoblasts exit the cell cycle, differentiate and fuse.
	GO:0010952	positive regulation of peptidase activity	Any process that increases the frequency, rate or extent of peptidase activity, the hydrolysis of peptide bonds within proteins.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0043627	response to estrogen	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by an estrogen, C18 steroid hormones that can stimulate the development of female sexual characteristics.
	GO:0009725	response to hormone	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hormone stimulus.
	GO:0001666	response to hypoxia	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
	GO:0009612	response to mechanical stimulus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mechanical stimulus.
	GO:0014070	response to organic cyclic compound	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
	GO:0006979	response to oxidative stress	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
	GO:0048771	tissue remodeling	The reorganization or renovation of existing tissues. This process can either change the characteristics of a tissue such as in blood vessel remodeling, or result in the dynamic equilibrium of a tissue such as in bone remodeling.
	GO:0031638	zymogen activation	The proteolytic processing of an inactive enzyme to an active form.
cellular component
	GO:0005796	Golgi lumen	The volume enclosed by the membranes of any cisterna or subcompartment of the Golgi apparatus, including the cis- and trans-Golgi networks.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0031410	cytoplasmic vesicle	A vesicle found in the cytoplasm of a cell.
	GO:0031012	extracellular matrix	A structure lying external to one or more cells, which provides structural support for cells or tissues.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0044354	macropinosome	A membrane-bounded, uncoated intracellular vesicle formed by the process of macropinocytosis.
	GO:0042470	melanosome	A tissue-specific, membrane-bounded cytoplasmic organelle within which melanin pigments are synthesized and stored. Melanosomes are synthesized in melanocyte cells.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Tyr A:353 - Pro A:354	[ RasMol ]
		Tyr A:399 - Pro A:400	[ RasMol ]
		Tyr A:449 - Pro A:450	[ RasMol ]
		Tyr A:497 - Pro A:498	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3c7x
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MMP14_HUMAN \| P50281
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.24.80
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MMP14_HUMAN \| P50281
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	MMP14_HUMAN \| P50281	:	1bqq 1buv 2mqs 3ma2 3x23 4p3c 4p3d 4qxu

(no "Related Entries Specified in the PDB File" available for 3C7X)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 2)

Sites (2, 2)

SS Bonds (1, 1)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 2)

PROSITE Motifs (2, 5)

Exons (5, 5)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (55, 55)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File