Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF I-SUBSTITUTED PHOTOSYSTEM II COMPLEX
 
Authors :  K. Kawakami, Y. Umena, N. Kamiya, J. -R. Shen
Date :  17 Mar 09  (Deposition) - 19 May 09  (Release) - 09 Jun 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  4.00
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,H,I,J,K,L,M,N,O,T,U,V,X,Y,Z,a,b,c,d,e,f,h,i,j,k,l,m,n,o,t,u,v,x,y,z
Keywords :  Multi-Membrane Protein Complex, Electron Transport, Herbicide Resistance, Iron, Membrane, Metal-Binding, Photosynthesis, Photosystem Ii, Thylakoid, Transmembrane, Transport, Heme, Reaction Center (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. Kawakami, Y. Umena, N. Kamiya, J. -R. Shen
Location Of Chloride And Its Possible Functions In Oxygen-Evolving Photosystem Ii Revealed By X-Ray Crystallography
Proc. Natl. Acad. Sci. Usa V. 106 8567 2009
PubMed-ID: 19433803  |  Reference-DOI: 10.1073/PNAS.0812797106
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PHOTOSYSTEM Q(B) PROTEIN
    Cellular Location: THYLAKOID MEMBRANE
    Chains: A, a
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
    Synonym: 32 KDA THYLAKOID MEMBRANE PROTEIN, PHOTOSYSTEM II PROTEIN D1
 
Molecule 2 - PHOTOSYSTEM II CORE LIGHT HARVESTING PROTEIN
    Cellular Location: THYLAKOID MEMBRANE
    Chains: B, b
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
 
Molecule 3 - PHOTOSYSTEM II CP43 PROTEIN
    Cellular Location: THYLAKOID MEMBRANE
    Chains: C, c
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
 
Molecule 4 - PHOTOSYSTEM II D2 PROTEIN
    Cellular Location: THYLAKOID MEMBRANE
    Chains: D, d
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
 
Molecule 5 - CYTOCHROME B559 SUBUNIT ALPHA
    Cellular Location: THYLAKOID MEMBRANE
    Chains: E, e
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
    Synonym: PSII REACTION CENTER SUBUNIT V
 
Molecule 6 - CYTOCHROME B559 SUBUNIT BETA
    Cellular Location: THYLAKOID MEMBRANE
    Chains: F, f
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
    Synonym: PSII REACTION CENTER SUBUNIT VI
 
Molecule 7 - PHOTOSYSTEM II REACTION CENTER PROTEIN H
    Cellular Location: THYLAKOID MEMBRANE
    Chains: H, h
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
 
Molecule 8 - PHOTOSYSTEM II REACTION CENTER PROTEIN I
    Cellular Location: THYLAKOID MEMBRANE
    Chains: I, i
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
 
Molecule 9 - PHOTOSYSTEM II REACTION CENTER PROTEIN J
    Cellular Location: THYLAKOID MEMBRANE
    Chains: J, j
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
    Synonym: PSII-J
 
Molecule 10 - PHOTOSYSTEM II REACTION CENTER PROTEIN K
    Cellular Location: THYLAKOID MEMBRANE
    Chains: K, k
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
 
Molecule 11 - PHOTOSYSTEM II REACTION CENTER PROTEIN L
    Cellular Location: THYLAKOID MEMBRANE
    Chains: L, l
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
    Synonym: PSII-L, PSII 5 KDA PROTEIN
 
Molecule 12 - PHOTOSYSTEM II REACTION CENTER PROTEIN M
    Cellular Location: THYLAKOID MEMBRANE
    Chains: M, m
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
 
Molecule 13 - PHOTOSYSTEM II MANGANESE-STABILIZING POLYPEPTIDE
    Cellular Location: THYLAKOID MEMBRANE
    Chains: O, o
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
 
Molecule 14 - PHOTOSYSTEM II REACTION CENTER PROTEIN T
    Cellular Location: THYLAKOID MEMBRANE
    Chains: T, t
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
    Synonym: PSII-T, PSII-TC
 
Molecule 15 - PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN
    Cellular Location: THYLAKOID MEMBRANE
    Chains: U, u
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
 
Molecule 16 - CYTOCHROME C-550
    Cellular Location: THYLAKOID MEMBRANE
    Chains: V, v
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
    Synonym: CYTOCHROME C550, LOW-POTENTIAL CYTOCHROME C
 
Molecule 17 - PHOTOSYSTEM II REACTION CENTER PROTEIN X
    Cellular Location: THYLAKOID MEMBRANE
    Chains: X, x
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
 
Molecule 18 - PHOTOSYSTEM II REACTION CENTER PROTEIN YCF12
    Cellular Location: THYLAKOID MEMBRANE
    Chains: Y, y
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
 
Molecule 19 - PHOTOSYSTEM II REACTION CENTER PROTEIN Y
    Cellular Location: THYLAKOID MEMBRANE
    Chains: N, n
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053
 
Molecule 20 - PHOTOSYSTEM II REACTION CENTER PROTEIN Z
    Cellular Location: THYLAKOID MEMBRANE
    Chains: Z, z
    Organism Common: SYNECHOCOCCUS VULCANUS
    Organism Scientific: THERMOSYNECHOCOCCUS VULCANUS
    Organism Taxid: 32053

 Structural Features

(-) Chains, Units

  12345678910111213141516171819202122232425262728293031323334353637383940
Asymmetric/Biological Unit : ABCDEFHIJKLMNOTUVXYZabcdefhijklmnotuvxyz

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (12, 182)

Asymmetric/Biological Unit (12, 182)
No.NameCountTypeFull Name
1BCR22Ligand/IonBETA-CAROTENE
2CLA70Ligand/IonCHLOROPHYLL A
3DGD8Ligand/IonDIGALACTOSYL DIACYL GLYCEROL (DGDG)
4FE22Ligand/IonFE (II) ION
5HEM4Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
6IOD10Ligand/IonIODIDE ION
7LHG2Ligand/Ion1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
8MGE8Ligand/Ion(1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE
9OEC2Ligand/IonOXYGEN EVOLVING SYSTEM
10PHO4Ligand/IonPHEOPHYTIN A
11PQ94Ligand/Ion5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE
12UNK46Mod. Amino Acid

(-) Sites  (135, 135)

Asymmetric Unit (135, 135)
No.NameEvidenceResiduesDescription
001AC1SOFTWAREGLN A:165 , ASP A:170 , GLU A:189 , HIS A:332 , GLU A:333 , HIS A:337 , ASP A:342 , ALA A:344 , GLU C:354 , ARG C:357BINDING SITE FOR RESIDUE OEC A 1001
002AC2SOFTWAREHIS A:215 , HIS A:272 , HIS D:214 , HIS D:268BINDING SITE FOR RESIDUE FE2 D 1002
003AC3SOFTWAREPHE A:119 , TYR A:147 , PRO A:150 , SER A:153 , VAL A:157 , MET A:183 , ILE A:184 , HIS A:198 , ARG A:279 , VAL A:283 , ALA A:286 , ILE A:290 , CLA A:1006 , PHO A:1038 , CLA D:1004 , CLA D:1005 , MGE D:1062BINDING SITE FOR RESIDUE CLA A 1003
004AC4SOFTWARETHR A:45 , VAL A:49 , MET A:172 , ILE A:176 , MET A:183 , CLA A:1003 , PHO A:1038 , HIS D:197 , MET D:198 , VAL D:201 , GLY D:206 , CLA D:1004 , PQ9 D:1042 , MGE D:1062BINDING SITE FOR RESIDUE CLA D 1005
005AC5SOFTWAREGLN A:199 , VAL A:202 , ALA A:203 , CLA A:1003 , PQ9 A:1043 , DGD C:1057 , PHE D:157 , VAL D:175 , PHE D:179 , LEU D:182 , CLA D:1004 , PHO D:1039 , BCR D:1050BINDING SITE FOR RESIDUE CLA A 1006
006AC6SOFTWAREILE A:36 , PRO A:39 , THR A:40 , PHE A:93 , PRO A:95 , ILE A:96 , TRP A:97 , LEU A:114 , HIS A:118 , LEU A:121 , BCR A:1044 , CLA C:1029 , VAL I:8 , TYR I:9 , VAL I:12 , THR I:13 , PHE I:15 , VAL I:16BINDING SITE FOR RESIDUE CLA A 1007
007AC7SOFTWARELEU A:41 , PHE A:48 , ILE A:115 , PHE A:119 , TYR A:126 , GLN A:130 , ALA A:146 , TYR A:147 , PRO A:150 , LEU A:174 , GLY A:175 , ARG A:279 , VAL A:280 , VAL A:283 , CLA A:1003 , LEU D:205 , LEU D:209 , ILE D:213 , TRP D:253 , CLA D:1005BINDING SITE FOR RESIDUE PHO A 1038
008AC8SOFTWAREPHE A:206 , ALA A:209 , LEU A:210 , ALA A:213 , MET A:214 , PHE A:255 , CLA A:1006 , PQ9 A:1043 , ALA D:41 , ALA D:44 , TRP D:48 , ILE D:114 , GLY D:118 , PHE D:125 , GLN D:129 , ASN D:142 , PHE D:146 , PHE D:173 , GLY D:174 , LEU D:279 , CLA D:1004BINDING SITE FOR RESIDUE PHO D 1039
009AC9SOFTWAREHIS A:215 , ALA A:251 , HIS A:252 , PHE A:255 , ILE A:259 , SER A:264 , PHE A:265 , LEU A:271 , PHE A:274 , CLA A:1006 , LEU D:45 , CLA D:1004 , PHO D:1039 , MGE D:1059BINDING SITE FOR RESIDUE PQ9 A 1043
010BC1SOFTWAREVAL A:35 , ILE A:38 , PRO A:39 , ALA A:43 , CYS A:47 , ILE A:50 , TRP A:105 , CLA A:1007 , PHE I:15BINDING SITE FOR RESIDUE BCR A 1044
011BC2SOFTWAREARG A:140 , TRP A:142 , TYR A:262 , PHE A:265 , SER A:270 , PHE A:273 , VAL A:281 , TRP C:36 , ARG C:447 , GLU C:456 , LYS C:457 , CLA C:1032 , GLY D:228 , ALA D:229 , SER D:230 , THR D:231 , PHE D:232 , CLA K:1034BINDING SITE FOR RESIDUE LHG A 1063
012BC3SOFTWAREHIS A:332 , GLU A:333 , LYS D:317BINDING SITE FOR RESIDUE IOD D 1064
013BC4SOFTWAREASN A:338 , PHE A:339BINDING SITE FOR RESIDUE IOD A 1065
014BC5SOFTWAREPHE B:190 , CLA B:1010 , PHE H:41 , BCR H:1049BINDING SITE FOR RESIDUE CLA B 1009
015BC6SOFTWAREGLY B:189 , PHE B:190 , GLY B:197 , HIS B:201 , ALA B:205 , VAL B:208 , PHE B:246 , PHE B:247 , PHE B:250 , VAL B:251 , CLA B:1009 , CLA B:1011 , CLA B:1013 , CLA B:1016 , DGD B:1058 , LEU D:158 , PHE H:41 , ILE H:45 , LEU H:46 , TYR H:49 , CLA H:1017BINDING SITE FOR RESIDUE CLA B 1010
016BC7SOFTWAREARG B:68 , LEU B:69 , LEU B:149 , CYS B:150 , PHE B:153 , HIS B:201 , HIS B:202 , ALA B:244 , PHE B:247 , ALA B:248 , THR B:262 , CLA B:1010 , CLA B:1012 , CLA B:1013 , CLA B:1014 , CLA B:1018 , PHE H:38 , CLA H:1017BINDING SITE FOR RESIDUE CLA B 1011
017BC8SOFTWARETRP B:33 , PHE B:61 , PHE B:65 , LEU B:149 , ALA B:248 , ALA B:249 , VAL B:252 , PHE B:451 , HIS B:455 , CLA B:1011 , CLA B:1013 , CLA B:1015 , CLA B:1020 , CLA B:1021 , CLA B:1023BINDING SITE FOR RESIDUE CLA B 1012
018BC9SOFTWARETHR B:27 , VAL B:30 , ALA B:31 , TRP B:33 , ALA B:34 , VAL B:62 , PHE B:65 , LEU B:69 , VAL B:96 , HIS B:100 , LEU B:103 , GLY B:147 , CLA B:1010 , CLA B:1011 , CLA B:1012 , CLA B:1014 , CLA B:1018BINDING SITE FOR RESIDUE CLA B 1013
019CC1SOFTWARELEU B:69 , VAL B:71 , TRP B:91 , ALA B:99 , HIS B:100 , LEU B:103 , LEU B:149 , GLY B:152 , PHE B:153 , HIS B:157 , PHE B:162 , PRO B:164 , CLA B:1011 , CLA B:1013 , BCR B:1048BINDING SITE FOR RESIDUE CLA B 1014
020CC2SOFTWARETRP B:33 , MET B:37 , TYR B:40 , GLY B:59 , PHE B:61 , LEU B:324 , THR B:327 , TRP B:450 , CLA B:1012 , CLA B:1021 , BCR B:1045 , BCR B:1047 , MGE B:1060 , LEU L:27 , BCR t:1046BINDING SITE FOR RESIDUE CLA B 1015
021CC3SOFTWARESER B:240 , ALA B:243 , PHE B:246 , PHE B:463 , HIS B:466 , GLY B:470 , THR B:473 , LEU B:474 , CLA B:1010 , CLA B:1018 , LEU D:89 , PHE D:120 , ILE D:123 , MET D:126 , LEU D:127 , PHE D:130 , CLA D:1008 , CLA H:1017BINDING SITE FOR RESIDUE CLA B 1016
022CC4SOFTWAREPHE B:139 , HIS B:216 , PRO B:221 , PRO B:222 , LEU B:225 , LEU B:229 , CLA B:1010 , CLA B:1011 , CLA B:1016 , CLA B:1018 , THR H:27 , THR H:28 , LEU H:30 , MET H:31 , PHE H:34 , MET H:35 , LEU H:46 , BCR H:1049BINDING SITE FOR RESIDUE CLA H 1017
023CC5SOFTWAREHIS B:23 , LEU B:135 , PRO B:136 , PHE B:139 , HIS B:142 , LEU B:229 , MET B:231 , VAL B:237 , SER B:240 , SER B:241 , CLA B:1011 , CLA B:1013 , CLA B:1016 , CLA B:1020 , CLA B:1023 , CLA H:1017BINDING SITE FOR RESIDUE CLA B 1018
024CC6SOFTWARETRP B:5 , TYR B:6 , ARG B:7 , HIS B:9 , THR B:10 , ILE B:242 , LEU B:461 , PHE B:462 , PHE B:464 , GLY B:465 , TRP B:468 , HIS B:469 , ARG B:472 , CLA B:1020 , CLA B:1021 , MGE B:1060 , MGE L:1061BINDING SITE FOR RESIDUE CLA B 1019
025CC7SOFTWAREHIS B:9 , LEU B:12 , HIS B:23 , HIS B:26 , THR B:27 , GLU B:235 , VAL B:237 , LEU B:238 , SER B:241 , CLA B:1012 , CLA B:1018 , CLA B:1019 , CLA B:1021 , CLA B:1023BINDING SITE FOR RESIDUE CLA B 1020
026CC8SOFTWAREHIS B:9 , HIS B:26 , VAL B:30 , PHE B:462 , CLA B:1012 , CLA B:1015 , CLA B:1019 , CLA B:1020 , CLA B:1022 , BCR B:1047 , MGE B:1060BINDING SITE FOR RESIDUE CLA B 1021
027CC9SOFTWAREVAL B:8 , HIS B:9 , LEU B:29 , CLA B:1021 , BCR B:1045 , ARG L:7 , VAL L:10 , PHE M:21 , ILE M:24 , LEU M:25 , SER m:5036BINDING SITE FOR RESIDUE CLA B 1022
028DC1SOFTWAREILE B:20 , HIS B:23 , LEU B:24 , MET B:138 , HIS B:142 , LEU B:145 , CLA B:1012 , CLA B:1018 , CLA B:1020 , CLA B:1024 , BCR B:1048 , ASN H:15BINDING SITE FOR RESIDUE CLA B 1023
029DC2SOFTWAREILE B:20 , LEU B:24 , LEU B:107 , TRP B:113 , HIS B:114 , LEU B:120 , PHE B:123 , CLA B:1023 , BCR B:1048 , THR H:5 , LEU H:7 , GLY H:8BINDING SITE FOR RESIDUE CLA B 1024
030DC3SOFTWAREMET B:25 , LEU B:29 , PHE B:108 , CLA B:1015 , CLA B:1022 , BCR B:1047BINDING SITE FOR RESIDUE BCR B 1045
031DC4SOFTWARELEU B:29 , GLY B:32 , TRP B:33 , SER B:36 , ILE B:101 , GLY B:105 , CLA B:1015 , CLA B:1021 , BCR B:1045 , BCR t:1046BINDING SITE FOR RESIDUE BCR B 1047
032DC5SOFTWARELEU B:106 , ALA B:110 , CLA B:1014 , CLA B:1023 , CLA B:1024 , PHE t:5018 , PHE t:5022BINDING SITE FOR RESIDUE BCR B 1048
033DC6SOFTWARECYS B:112 , TRP B:115BINDING SITE FOR RESIDUE IOD B 1067
034DC7SOFTWARELEU C:95 , LEU C:168 , GLY C:171 , ALA C:172 , HIS C:237 , ILE C:240 , MET C:282 , CLA C:1026 , CLA C:1031 , BCR C:1054BINDING SITE FOR RESIDUE CLA C 1025
035DC8SOFTWARETRP C:63 , HIS C:91 , LEU C:279 , GLY C:283 , ALA C:286 , TYR C:297 , HIS C:430 , LEU C:433 , ALA C:434 , PHE C:437 , CLA C:1025 , CLA C:1027 , CLA C:1028 , CLA C:1033 , CLA K:1034BINDING SITE FOR RESIDUE CLA C 1026
036DC9SOFTWAREILE C:60 , LEU C:88 , VAL C:117 , HIS C:118 , SER C:121 , CLA C:1026 , CLA C:1036 , BCR Z:1053BINDING SITE FOR RESIDUE CLA C 1027
037EC1SOFTWARETRP C:63 , MET C:67 , PHE C:70 , GLY C:85 , ILE C:87 , SER C:406 , TRP C:425 , SER C:429 , CLA C:1026 , DGD C:1056 , DGD C:1057 , PRO K:26 , CLA K:1034BINDING SITE FOR RESIDUE CLA C 1028
038EC2SOFTWAREPHE A:33 , ILE A:36 , TRP A:131 , CLA A:1007 , TYR C:274 , GLY C:277 , MET C:281 , HIS C:441 , LEU C:442 , ARG C:449 , CLA C:1031 , BCR C:1054 , PHE I:23BINDING SITE FOR RESIDUE CLA C 1029
039EC3SOFTWARELEU C:161 , LEU C:165 , ILE C:243 , GLY C:247 , TRP C:250 , HIS C:251 , PHE C:257 , PHE C:264 , CLA C:1031 , BCR C:1054BINDING SITE FOR RESIDUE CLA C 1030
040EC4SOFTWAREMET C:157 , ILE C:160 , LEU C:161 , HIS C:164 , LEU C:165 , LEU C:168 , TYR C:271 , TYR C:274 , SER C:275 , CLA C:1025 , CLA C:1029 , CLA C:1030 , CLA C:1033 , BCR C:1054BINDING SITE FOR RESIDUE CLA C 1031
041EC5SOFTWARELHG A:1063 , TRP C:36 , ASN C:39 , LEU C:272 , LEU C:276 , PHE C:436 , PHE C:437 , VAL C:439 , GLY C:440 , TRP C:443 , HIS C:444 , ARG C:447 , CLA C:1033 , CLA C:1035 , DGD C:1056 , PHE K:33 , PHE K:37 , CLA K:1034BINDING SITE FOR RESIDUE CLA C 1032
042EC6SOFTWAREASN C:39 , ILE C:43 , HIS C:53 , HIS C:56 , TRP C:151 , ILE C:160 , HIS C:164 , GLY C:268 , GLU C:269 , LEU C:272 , SER C:275 , CLA C:1026 , CLA C:1031 , CLA C:1032 , CLA C:1036 , CLA K:1034BINDING SITE FOR RESIDUE CLA C 1033
043EC7SOFTWARELHG A:1063 , HIS C:56 , LEU C:59 , ILE C:60 , CLA C:1026 , CLA C:1028 , CLA C:1032 , CLA C:1033 , CLA C:1035 , PRO K:29 , VAL K:30 , PHE K:33BINDING SITE FOR RESIDUE CLA K 1034
044EC8SOFTWARETRP C:35 , GLY C:38 , ASN C:39 , ARG C:41 , LEU C:42 , LYS C:48 , LEU C:49 , ALA C:52 , VAL C:130 , CLA C:1032 , BCR C:1052 , PHE K:37 , GLN K:40 , CLA K:1034 , BCR K:1051 , LEU Y:39 , ASN Y:45 , VAL Z:20 , VAL Z:23BINDING SITE FOR RESIDUE CLA C 1035
045EC9SOFTWAREHIS C:53 , ALA C:57 , LEU C:125 , PHE C:147 , GLY C:148 , ILE C:160 , PHE C:163 , HIS C:164 , VAL C:167 , ILE C:170 , CLA C:1027 , CLA C:1033 , CLA C:1037 , BCR Z:1053BINDING SITE FOR RESIDUE CLA C 1036
046FC1SOFTWARELEU C:50 , VAL C:124 , GLY C:128 , TYR C:131 , HIS C:132 , PRO C:137 , TYR C:143 , PHE C:146 , CLA C:1036 , BCR Z:1053BINDING SITE FOR RESIDUE CLA C 1037
047FC2SOFTWAREALA C:55 , PHE C:62 , LEU C:119 , SER C:122 , ALA C:123 , GLY C:126 , CLA C:1035 , PHE K:32 , BCR K:1051 , LEU Z:9 , LEU Z:12BINDING SITE FOR RESIDUE BCR C 1052
048FC3SOFTWAREVAL C:116 , VAL C:117 , SER C:121 , CLA C:1027 , CLA C:1036 , CLA C:1037 , VAL Z:54 , GLY Z:55 , ASN Z:58BINDING SITE FOR RESIDUE BCR Z 1053
049FC4SOFTWAREILE C:209 , ILE C:224 , CLA C:1025 , CLA C:1029 , CLA C:1030 , CLA C:1031BINDING SITE FOR RESIDUE BCR C 1054
050FC5SOFTWARELEU A:91 , LEU A:121 , LEU A:151 , PHE A:155 , LEU A:159 , ILE A:163 , PRO C:217 , PHE C:218 , GLY C:219 , GLY C:220 , GLY C:222 , VAL C:225 , SER C:226 , ASN C:228 , PHE C:284 , CYS C:288 , PHE C:292 , ASN C:293 , ASN C:294 , ASP C:360 , ARG C:362BINDING SITE FOR RESIDUE DGD C 1055
051FC6SOFTWAREPHE A:197 , LEU A:200 , PHE A:285 , LEU A:297 , GLU C:83 , GLY C:85 , SER C:406 , ASN C:418 , TRP C:425 , SER C:429 , CLA C:1028 , CLA C:1032 , DGD C:1057 , PHE J:29 , TYR J:33BINDING SITE FOR RESIDUE DGD C 1056
052FC7SOFTWAREPRO A:196 , GLN A:199 , LEU A:200 , TRP A:278 , SER A:305 , CLA A:1006 , ASN C:405 , ASN C:415 , SER C:416 , ASN C:418 , CLA C:1028 , DGD C:1056 , MGE D:1059 , PHE J:29 , ALA J:32 , TYR J:33 , GLY J:37 , SER J:38 , SER J:39 , GLN V:60BINDING SITE FOR RESIDUE DGD C 1057
053FC8SOFTWAREMET A:183 , PHE A:206 , CLA A:1003 , CLA A:1006 , PQ9 A:1043 , LEU D:45 , TRP D:48 , LEU D:122 , PRO D:149 , VAL D:152 , PHE D:153 , VAL D:156 , PHE D:181 , LEU D:182 , PHE D:185 , GLN D:186 , TRP D:191 , THR D:192 , HIS D:197 , GLY D:200 , VAL D:201 , VAL D:204 , LEU D:279 , SER D:282 , ALA D:283 , VAL D:286 , CLA D:1005 , PHO D:1039 , MGE D:1059BINDING SITE FOR RESIDUE CLA D 1004
054FC9SOFTWARECLA B:1016 , PRO D:39 , CYS D:40 , LEU D:43 , LEU D:90 , LEU D:91 , LEU D:92 , TRP D:93 , PHE D:113 , HIS D:117 , MET H:35 , VAL H:40 , VAL X:29BINDING SITE FOR RESIDUE CLA D 1008
055GC1SOFTWAREMET D:199 , ALA D:202 , LEU D:209 , LEU D:210 , ILE D:213 , THR D:217 , ALA D:249 , TRP D:253 , ALA D:260 , PHE D:261 , LEU D:267 , PHE D:270 , VAL D:274 , CLA D:1005 , MGE D:1062 , VAL L:26 , LEU L:27 , LEU L:29 , LEU L:30 , MGE L:1061BINDING SITE FOR RESIDUE PQ9 D 1042
056GC2SOFTWARECLA A:1006 , LEU D:43 , GLY D:46 , GLY D:47 , LEU D:49 , THR D:50 , PHE D:113 , MGE D:1059 , THR F:30 , PHE F:33 , LEU F:34 , VAL J:21BINDING SITE FOR RESIDUE BCR D 1050
057GC3SOFTWAREPQ9 A:1043 , DGD C:1057 , LEU D:49 , TYR D:67 , GLY D:70 , CYS D:71 , ASN D:72 , PHE D:73 , CLA D:1004 , BCR D:1050 , MET F:40 , GLN F:41 , PHE J:28 , GLY J:31 , ALA J:32 , GLY J:35 , LEU J:36BINDING SITE FOR RESIDUE MGE D 1059
058GC4SOFTWAREASN A:234 , TRP B:5 , TYR B:6 , ARG B:7 , PHE B:464 , TRP B:468 , CLA B:1015 , CLA B:1019 , CLA B:1021 , TYR D:141 , ARG D:265 , PHE D:269 , VAL D:276 , TRP D:280 , LEU L:23 , MGE L:1061BINDING SITE FOR RESIDUE MGE B 1060
059GC5SOFTWARECLA A:1003 , PHE D:257 , ILE D:259 , ALA D:260 , PHE D:261 , SER D:262 , TRP D:266 , CLA D:1005 , PQ9 D:1042 , ASN L:13 , THR L:15 , LEU L:19 , LEU L:22 , VAL L:26 , PHE T:17 , ALA T:20 , ILE T:21 , GLU T:25BINDING SITE FOR RESIDUE MGE D 1062
060GC6SOFTWAREPHE B:362 , TYR D:160 , GLN D:164BINDING SITE FOR RESIDUE IOD D 1068
061GC7SOFTWAREILE E:13 , HIS E:23 , THR E:26 , ILE E:27 , LEU E:30 , ILE F:15 , PHE F:16 , ARG F:19 , TRP F:20 , HIS F:24 , ALA F:27 , UNK N:11 , UNK N:15BINDING SITE FOR RESIDUE HEM F 1040
062GC8SOFTWARECLA B:1009 , PHE H:34 , MET H:35 , LEU H:37 , PHE H:38 , PHE H:41 , CLA H:1017 , LEU X:16 , PHE X:20BINDING SITE FOR RESIDUE BCR H 1049
063GC9SOFTWARETYR B:193 , PHE B:250 , TYR B:258 , TYR B:273 , GLN B:274 , THR B:452 , ALA B:456 , LEU B:460 , PHE B:463 , CLA B:1010 , GLY D:86 , HIS D:87 , LEU D:116 , VAL D:154 , ILE D:159 , LEU D:162 , SER D:165 , VAL D:287 , LEU H:46 , TYR H:49 , ASN H:50 , VAL H:60 , SER H:61 , TRP H:62BINDING SITE FOR RESIDUE DGD B 1058
064HC1SOFTWARESER A:232 , ASN A:234 , TRP B:5 , TYR B:6 , CLA B:1019 , MGE B:1060 , TRP D:266 , PHE D:273 , PQ9 D:1042 , GLU L:11 , ASN L:13 , SER L:16 , GLY L:20 , LEU L:22 , VAL L:26 , VAL M:17 , PRO M:18 , PHE M:21 , LEU M:22BINDING SITE FOR RESIDUE MGE L 1061
065HC2SOFTWAREPHE T:8 , CYS T:12BINDING SITE FOR RESIDUE IOD T 1066
066HC3SOFTWAREPHE T:8 , ALA T:11 , ILE T:14 , ALA T:15 , PHE T:17 , PHE T:18 , ILE T:21 , SER b:5036 , CLA b:6015 , BCR b:6047BINDING SITE FOR RESIDUE BCR T 6046
067HC4SOFTWAREALA V:62 , CYS V:66 , HIS V:67 , THR V:74 , LEU V:78 , LEU V:85 , TYR V:101 , TYR V:108 , ILE V:114 , HIS V:118 , ILE V:145BINDING SITE FOR RESIDUE HEM V 1041
068HC5SOFTWARECLA C:1035 , BCR C:1052 , ALA J:14 , THR J:15 , GLY J:18 , MET J:19 , ILE K:28 , LEU K:31 , ALA K:34 , LEU K:35 , PHE K:37 , ILE Y:28 , GLY Y:29 , GLY Y:32BINDING SITE FOR RESIDUE BCR K 1051
069HC6SOFTWAREGLN a:5165 , ASP a:5170 , GLU a:5189 , HIS a:5332 , GLU a:5333 , HIS a:5337 , ASP a:5342 , ALA a:5344 , GLU c:5354 , ARG c:5357BINDING SITE FOR RESIDUE OEC A 6001
070HC7SOFTWAREHIS a:5215 , HIS a:5272 , HIS d:5214 , HIS d:5268BINDING SITE FOR RESIDUE FE2 A 6002
071HC8SOFTWAREPHE a:5119 , TYR a:5147 , PRO a:5150 , SER a:5153 , VAL a:5157 , MET a:5183 , ILE a:5184 , HIS a:5198 , ARG a:5279 , VAL a:5283 , ALA a:5286 , ILE a:5290 , CLA a:6006 , PHO a:6038 , CLA d:6004 , CLA d:6005 , MGE d:6062BINDING SITE FOR RESIDUE CLA A 6003
072HC9SOFTWARETHR a:5045 , VAL a:5049 , MET a:5172 , ILE a:5176 , MET a:5183 , CLA a:6003 , PHO a:6038 , HIS d:5197 , MET d:5198 , VAL d:5201 , GLY d:5206 , CLA d:6004 , PQ9 d:6042 , MGE d:6062BINDING SITE FOR RESIDUE CLA D 6005
073IC1SOFTWAREGLN a:5199 , VAL a:5202 , ALA a:5203 , CLA a:6003 , PQ9 a:6043 , DGD c:6057 , PHE d:5157 , VAL d:5175 , PHE d:5179 , LEU d:5182 , CLA d:6004 , PHO d:6039 , BCR d:6050BINDING SITE FOR RESIDUE CLA A 6006
074IC2SOFTWAREILE a:5036 , PRO a:5039 , THR a:5040 , PHE a:5093 , PRO a:5095 , ILE a:5096 , TRP a:5097 , LEU a:5114 , HIS a:5118 , LEU a:5121 , BCR a:6044 , CLA c:6029 , VAL i:5008 , TYR i:5009 , VAL i:5012 , THR i:5013 , PHE i:5015 , VAL i:5016BINDING SITE FOR RESIDUE CLA A 6007
075IC3SOFTWARELEU a:5041 , PHE a:5048 , ILE a:5115 , PHE a:5119 , TYR a:5126 , GLN a:5130 , ALA a:5146 , TYR a:5147 , PRO a:5150 , LEU a:5174 , GLY a:5175 , ARG a:5279 , VAL a:5280 , VAL a:5283 , CLA a:6003 , LEU d:5205 , LEU d:5209 , ILE d:5213 , TRP d:5253 , CLA d:6005BINDING SITE FOR RESIDUE PHO A 6038
076IC4SOFTWAREPHE a:5206 , ALA a:5209 , LEU a:5210 , ALA a:5213 , MET a:5214 , PHE a:5255 , CLA a:6006 , PQ9 a:6043 , ALA d:5041 , ALA d:5044 , TRP d:5048 , ILE d:5114 , GLY d:5118 , PHE d:5125 , GLN d:5129 , ASN d:5142 , PHE d:5146 , PHE d:5173 , GLY d:5174 , LEU d:5279 , CLA d:6004BINDING SITE FOR RESIDUE PHO D 6039
077IC5SOFTWAREHIS a:5215 , ALA a:5251 , HIS a:5252 , PHE a:5255 , ILE a:5259 , SER a:5264 , PHE a:5265 , LEU a:5271 , PHE a:5274 , CLA a:6006 , LEU d:5045 , CLA d:6004 , PHO d:6039 , MGE d:6059BINDING SITE FOR RESIDUE PQ9 A 6043
078IC6SOFTWAREVAL a:5035 , ILE a:5038 , PRO a:5039 , ALA a:5043 , CYS a:5047 , ILE a:5050 , TRP a:5105 , CLA a:6007 , PHE i:5015BINDING SITE FOR RESIDUE BCR A 6044
079IC7SOFTWAREARG a:5140 , TRP a:5142 , TYR a:5262 , PHE a:5265 , SER a:5270 , PHE a:5273 , VAL a:5281 , TRP c:5036 , ARG c:5447 , GLU c:5456 , LYS c:5457 , CLA c:6032 , GLY d:5228 , ALA d:5229 , SER d:5230 , THR d:5231 , PHE d:5232 , CLA k:6034BINDING SITE FOR RESIDUE LHG A 6063
080IC8SOFTWAREHIS a:5332 , GLU a:5333 , LYS d:5317BINDING SITE FOR RESIDUE IOD D 6064
081IC9SOFTWAREPHE b:5190 , CLA b:6010 , PHE h:5041 , BCR h:6049BINDING SITE FOR RESIDUE CLA B 6009
082JC1SOFTWAREGLY b:5189 , PHE b:5190 , GLY b:5197 , HIS b:5201 , ALA b:5205 , VAL b:5208 , PHE b:5246 , PHE b:5247 , PHE b:5250 , VAL b:5251 , CLA b:6009 , CLA b:6011 , CLA b:6013 , CLA b:6016 , DGD b:6058 , LEU d:5158 , PHE h:5041 , ILE h:5045 , LEU h:5046 , TYR h:5049 , CLA h:6017BINDING SITE FOR RESIDUE CLA B 6010
083JC2SOFTWAREARG b:5068 , LEU b:5069 , LEU b:5149 , CYS b:5150 , PHE b:5153 , HIS b:5201 , HIS b:5202 , ALA b:5244 , PHE b:5247 , ALA b:5248 , THR b:5262 , CLA b:6010 , CLA b:6012 , CLA b:6013 , CLA b:6014 , CLA b:6018 , PHE h:5038 , CLA h:6017BINDING SITE FOR RESIDUE CLA B 6011
084JC3SOFTWARETRP b:5033 , PHE b:5061 , PHE b:5065 , LEU b:5149 , ALA b:5248 , ALA b:5249 , VAL b:5252 , PHE b:5451 , HIS b:5455 , CLA b:6011 , CLA b:6013 , CLA b:6015 , CLA b:6020 , CLA b:6021 , CLA b:6023BINDING SITE FOR RESIDUE CLA B 6012
085JC4SOFTWARETHR b:5027 , VAL b:5030 , ALA b:5031 , TRP b:5033 , ALA b:5034 , VAL b:5062 , PHE b:5065 , LEU b:5069 , VAL b:5096 , HIS b:5100 , LEU b:5103 , GLY b:5147 , CLA b:6010 , CLA b:6011 , CLA b:6012 , CLA b:6014 , CLA b:6018BINDING SITE FOR RESIDUE CLA B 6013
086JC5SOFTWAREBCR T:6048 , LEU b:5069 , VAL b:5071 , TRP b:5091 , ALA b:5099 , HIS b:5100 , LEU b:5103 , LEU b:5149 , GLY b:5152 , PHE b:5153 , HIS b:5157 , PHE b:5162 , PRO b:5164 , CLA b:6011 , CLA b:6013BINDING SITE FOR RESIDUE CLA B 6014
087JC6SOFTWAREBCR T:6046 , TRP b:5033 , MET b:5037 , TYR b:5040 , GLY b:5059 , PHE b:5061 , LEU b:5324 , THR b:5327 , TRP b:5450 , CLA b:6012 , CLA b:6021 , BCR b:6045 , BCR b:6047 , MGE b:6060 , LEU l:5027BINDING SITE FOR RESIDUE CLA B 6015
088JC7SOFTWARESER b:5240 , ALA b:5243 , PHE b:5246 , PHE b:5463 , HIS b:5466 , GLY b:5470 , THR b:5473 , LEU b:5474 , CLA b:6010 , CLA b:6018 , LEU d:5089 , PHE d:5120 , ILE d:5123 , MET d:5126 , LEU d:5127 , PHE d:5130 , CLA d:6008 , CLA h:6017BINDING SITE FOR RESIDUE CLA B 6016
089JC8SOFTWAREPHE b:5139 , HIS b:5216 , PRO b:5221 , PRO b:5222 , LEU b:5225 , LEU b:5229 , CLA b:6010 , CLA b:6011 , CLA b:6016 , CLA b:6018 , THR h:5027 , THR h:5028 , LEU h:5030 , MET h:5031 , PHE h:5034 , MET h:5035 , LEU h:5046 , BCR h:6049BINDING SITE FOR RESIDUE CLA H 6017
090JC9SOFTWAREHIS b:5023 , LEU b:5135 , PRO b:5136 , PHE b:5139 , HIS b:5142 , LEU b:5229 , MET b:5231 , VAL b:5237 , SER b:5240 , SER b:5241 , CLA b:6011 , CLA b:6013 , CLA b:6016 , CLA b:6020 , CLA b:6023 , CLA h:6017BINDING SITE FOR RESIDUE CLA B 6018
091KC1SOFTWARETRP b:5005 , TYR b:5006 , ARG b:5007 , HIS b:5009 , THR b:5010 , ILE b:5242 , LEU b:5461 , PHE b:5462 , PHE b:5464 , GLY b:5465 , TRP b:5468 , HIS b:5469 , ARG b:5472 , CLA b:6020 , CLA b:6021 , MGE b:6060 , MGE l:6061BINDING SITE FOR RESIDUE CLA B 6019
092KC2SOFTWAREHIS b:5009 , LEU b:5012 , HIS b:5023 , HIS b:5026 , THR b:5027 , GLU b:5235 , VAL b:5237 , LEU b:5238 , SER b:5241 , CLA b:6012 , CLA b:6018 , CLA b:6019 , CLA b:6021 , CLA b:6023BINDING SITE FOR RESIDUE CLA B 6020
093KC3SOFTWAREHIS b:5009 , HIS b:5026 , VAL b:5030 , PHE b:5462 , CLA b:6012 , CLA b:6015 , CLA b:6019 , CLA b:6020 , CLA b:6022 , BCR b:6047 , MGE b:6060BINDING SITE FOR RESIDUE CLA B 6021
094KC4SOFTWARESER M:36 , VAL b:5008 , HIS b:5009 , LEU b:5029 , CLA b:6021 , BCR b:6045 , ARG l:5007 , VAL l:5010 , PHE m:5021 , ILE m:5024 , LEU m:5025BINDING SITE FOR RESIDUE CLA B 6022
095KC5SOFTWAREBCR T:6048 , ILE b:5020 , HIS b:5023 , LEU b:5024 , MET b:5138 , HIS b:5142 , LEU b:5145 , CLA b:6012 , CLA b:6018 , CLA b:6020 , CLA b:6024 , ASN h:5015BINDING SITE FOR RESIDUE CLA B 6023
096KC6SOFTWAREBCR T:6048 , ILE b:5020 , LEU b:5024 , LEU b:5107 , TRP b:5113 , HIS b:5114 , LEU b:5120 , PHE b:5123 , CLA b:6023 , THR h:5005 , LEU h:5007 , GLY h:5008BINDING SITE FOR RESIDUE CLA B 6024
097KC7SOFTWAREPHE T:19 , MET b:5025 , LEU b:5029 , PHE b:5108 , CLA b:6015 , CLA b:6022 , BCR b:6047BINDING SITE FOR RESIDUE BCR B 6045
098KC8SOFTWAREBCR T:6046 , LEU b:5029 , GLY b:5032 , TRP b:5033 , SER b:5036 , ILE b:5101 , GLY b:5105 , CLA b:6015 , CLA b:6021 , BCR b:6045BINDING SITE FOR RESIDUE BCR B 6047
099KC9SOFTWAREPHE T:18 , PHE T:22 , LEU b:5106 , ALA b:5110 , CLA b:6014 , CLA b:6023 , CLA b:6024BINDING SITE FOR RESIDUE BCR T 6048
100LC1SOFTWARECYS b:5112BINDING SITE FOR RESIDUE IOD B 6067
101LC2SOFTWARELEU c:5095 , LEU c:5168 , GLY c:5171 , ALA c:5172 , HIS c:5237 , ILE c:5240 , MET c:5282 , CLA c:6026 , CLA c:6031 , BCR c:6054BINDING SITE FOR RESIDUE CLA C 6025
102LC3SOFTWARETRP c:5063 , HIS c:5091 , LEU c:5279 , GLY c:5283 , ALA c:5286 , TYR c:5297 , HIS c:5430 , LEU c:5433 , ALA c:5434 , PHE c:5437 , CLA c:6025 , CLA c:6027 , CLA c:6028 , CLA c:6033 , CLA k:6034BINDING SITE FOR RESIDUE CLA C 6026
103LC4SOFTWAREILE c:5060 , LEU c:5088 , VAL c:5117 , HIS c:5118 , SER c:5121 , CLA c:6026 , CLA c:6036 , BCR z:6053BINDING SITE FOR RESIDUE CLA C 6027
104LC5SOFTWARETRP c:5063 , MET c:5067 , PHE c:5070 , GLY c:5085 , ILE c:5087 , SER c:5406 , TRP c:5425 , SER c:5429 , CLA c:6026 , DGD c:6056 , DGD c:6057 , PRO k:5026 , CLA k:6034BINDING SITE FOR RESIDUE CLA C 6028
105LC6SOFTWAREPHE a:5033 , ILE a:5036 , TRP a:5131 , CLA a:6007 , TYR c:5274 , GLY c:5277 , MET c:5281 , HIS c:5441 , LEU c:5442 , ARG c:5449 , CLA c:6031 , BCR c:6054 , PHE i:5023BINDING SITE FOR RESIDUE CLA C 6029
106LC7SOFTWARELEU c:5161 , LEU c:5165 , ILE c:5243 , GLY c:5247 , TRP c:5250 , HIS c:5251 , PHE c:5257 , PHE c:5264 , CLA c:6031 , BCR c:6054BINDING SITE FOR RESIDUE CLA C 6030
107LC8SOFTWAREMET c:5157 , ILE c:5160 , LEU c:5161 , HIS c:5164 , LEU c:5165 , LEU c:5168 , TYR c:5271 , TYR c:5274 , SER c:5275 , CLA c:6025 , CLA c:6029 , CLA c:6030 , CLA c:6033 , BCR c:6054BINDING SITE FOR RESIDUE CLA C 6031
108LC9SOFTWARELHG a:6063 , TRP c:5036 , ASN c:5039 , LEU c:5272 , LEU c:5276 , PHE c:5436 , PHE c:5437 , VAL c:5439 , GLY c:5440 , TRP c:5443 , HIS c:5444 , ARG c:5447 , CLA c:6033 , CLA c:6035 , DGD c:6056 , PHE k:5033 , PHE k:5037 , CLA k:6034BINDING SITE FOR RESIDUE CLA C 6032
109MC1SOFTWAREASN c:5039 , ILE c:5043 , HIS c:5053 , HIS c:5056 , TRP c:5151 , ILE c:5160 , HIS c:5164 , GLY c:5268 , GLU c:5269 , LEU c:5272 , SER c:5275 , CLA c:6026 , CLA c:6031 , CLA c:6032 , CLA c:6036 , CLA k:6034BINDING SITE FOR RESIDUE CLA C 6033
110MC2SOFTWARELHG a:6063 , HIS c:5056 , LEU c:5059 , ILE c:5060 , CLA c:6026 , CLA c:6028 , CLA c:6032 , CLA c:6033 , CLA c:6035 , PRO k:5029 , VAL k:5030 , PHE k:5033BINDING SITE FOR RESIDUE CLA K 6034
111MC3SOFTWARETRP c:5035 , GLY c:5038 , ASN c:5039 , ARG c:5041 , LEU c:5042 , LYS c:5048 , LEU c:5049 , ALA c:5052 , VAL c:5130 , CLA c:6032 , PHE k:5037 , GLN k:5040 , CLA k:6034 , BCR k:6051 , BCR k:6052 , LEU y:5039 , ASN y:5045 , VAL z:5020 , VAL z:5023BINDING SITE FOR RESIDUE CLA C 6035
112MC4SOFTWAREHIS c:5053 , ALA c:5057 , LEU c:5125 , PHE c:5147 , GLY c:5148 , ILE c:5160 , PHE c:5163 , HIS c:5164 , VAL c:5167 , ILE c:5170 , CLA c:6027 , CLA c:6033 , CLA c:6037 , BCR z:6053BINDING SITE FOR RESIDUE CLA C 6036
113MC5SOFTWARELEU c:5050 , VAL c:5124 , GLY c:5128 , TYR c:5131 , HIS c:5132 , PRO c:5137 , TYR c:5143 , PHE c:5146 , CLA c:6036 , BCR z:6053BINDING SITE FOR RESIDUE CLA C 6037
114MC6SOFTWAREALA c:5055 , PHE c:5062 , LEU c:5119 , SER c:5122 , ALA c:5123 , GLY c:5126 , CLA c:6035 , PHE k:5032 , BCR k:6051 , LEU z:5009 , LEU z:5012BINDING SITE FOR RESIDUE BCR K 6052
115MC7SOFTWAREVAL c:5116 , VAL c:5117 , SER c:5121 , CLA c:6027 , CLA c:6036 , CLA c:6037 , VAL z:5054 , GLY z:5055 , ASN z:5058BINDING SITE FOR RESIDUE BCR Z 6053
116MC8SOFTWAREILE c:5209 , ILE c:5224 , CLA c:6025 , CLA c:6029 , CLA c:6030 , CLA c:6031BINDING SITE FOR RESIDUE BCR C 6054
117MC9SOFTWARELEU a:5091 , LEU a:5121 , LEU a:5151 , PHE a:5155 , LEU a:5159 , ILE a:5163 , PRO c:5217 , PHE c:5218 , GLY c:5219 , GLY c:5220 , GLY c:5222 , VAL c:5225 , SER c:5226 , ASN c:5228 , PHE c:5284 , CYS c:5288 , PHE c:5292 , ASN c:5293 , ASN c:5294 , ASP c:5360 , ARG c:5362BINDING SITE FOR RESIDUE DGD C 6055
118NC1SOFTWAREPHE a:5197 , LEU a:5200 , PHE a:5285 , LEU a:5297 , GLU c:5083 , GLY c:5085 , SER c:5406 , ASN c:5418 , TRP c:5425 , SER c:5429 , CLA c:6028 , CLA c:6032 , DGD c:6057 , PHE j:5029 , TYR j:5033BINDING SITE FOR RESIDUE DGD C 6056
119NC2SOFTWAREPRO a:5196 , GLN a:5199 , LEU a:5200 , TRP a:5278 , SER a:5305 , CLA a:6006 , ASN c:5405 , ASN c:5415 , SER c:5416 , ASN c:5418 , CLA c:6028 , DGD c:6056 , MGE d:6059 , PHE j:5029 , ALA j:5032 , TYR j:5033 , GLY j:5037 , SER j:5038 , SER j:5039 , GLN v:5060BINDING SITE FOR RESIDUE DGD C 6057
120NC3SOFTWAREMET a:5183 , PHE a:5206 , CLA a:6003 , CLA a:6006 , PQ9 a:6043 , LEU d:5045 , TRP d:5048 , LEU d:5122 , PRO d:5149 , VAL d:5152 , PHE d:5153 , VAL d:5156 , PHE d:5181 , LEU d:5182 , PHE d:5185 , GLN d:5186 , TRP d:5191 , THR d:5192 , HIS d:5197 , GLY d:5200 , VAL d:5201 , VAL d:5204 , LEU d:5279 , SER d:5282 , ALA d:5283 , VAL d:5286 , CLA d:6005 , PHO d:6039 , MGE d:6059BINDING SITE FOR RESIDUE CLA D 6004
121NC4SOFTWARECLA b:6016 , PRO d:5039 , CYS d:5040 , LEU d:5043 , LEU d:5090 , LEU d:5091 , LEU d:5092 , TRP d:5093 , PHE d:5113 , HIS d:5117 , MET h:5035 , VAL h:5040 , VAL x:5029BINDING SITE FOR RESIDUE CLA D 6008
122NC5SOFTWAREMET d:5199 , ALA d:5202 , LEU d:5209 , LEU d:5210 , ILE d:5213 , THR d:5217 , ALA d:5249 , TRP d:5253 , ALA d:5260 , PHE d:5261 , LEU d:5267 , PHE d:5270 , VAL d:5274 , CLA d:6005 , MGE d:6062 , VAL l:5026 , LEU l:5027 , LEU l:5029 , LEU l:5030 , MGE l:6061BINDING SITE FOR RESIDUE PQ9 D 6042
123NC6SOFTWARECLA a:6006 , LEU d:5043 , GLY d:5046 , GLY d:5047 , LEU d:5049 , THR d:5050 , PHE d:5113 , MGE d:6059 , THR f:5030 , PHE f:5033 , LEU f:5034 , VAL j:5021BINDING SITE FOR RESIDUE BCR D 6050
124NC7SOFTWAREPQ9 a:6043 , DGD c:6057 , LEU d:5049 , TYR d:5067 , GLY d:5070 , CYS d:5071 , ASN d:5072 , PHE d:5073 , CLA d:6004 , BCR d:6050 , MET f:5040 , GLN f:5041 , PHE j:5028 , GLY j:5031 , ALA j:5032 , GLY j:5035 , LEU j:5036BINDING SITE FOR RESIDUE MGE D 6059
125NC8SOFTWAREASN a:5234 , TRP b:5005 , TYR b:5006 , ARG b:5007 , PHE b:5464 , TRP b:5468 , CLA b:6015 , CLA b:6019 , CLA b:6021 , TYR d:5141 , ARG d:5265 , PHE d:5269 , VAL d:5276 , TRP d:5280 , LEU l:5023 , MGE l:6061BINDING SITE FOR RESIDUE MGE B 6060
126NC9SOFTWARECLA a:6003 , PHE d:5257 , ILE d:5259 , ALA d:5260 , PHE d:5261 , SER d:5262 , TRP d:5266 , CLA d:6005 , PQ9 d:6042 , ASN l:5013 , THR l:5015 , LEU l:5019 , LEU l:5022 , VAL l:5026 , PHE t:5017 , ALA t:5020 , ILE t:5021 , GLU t:5025BINDING SITE FOR RESIDUE MGE D 6062
127OC1SOFTWARETYR d:5160 , PHE d:5169 , PHE d:5184BINDING SITE FOR RESIDUE IOD D 6068
128OC2SOFTWAREILE e:5013 , HIS e:5023 , THR e:5026 , ILE e:5027 , LEU e:5030 , ILE f:5015 , PHE f:5016 , ARG f:5019 , TRP f:5020 , HIS f:5024 , ALA f:5027 , UNK n:5011 , UNK n:5015BINDING SITE FOR RESIDUE HEM F 6040
129OC3SOFTWARECLA b:6009 , PHE h:5034 , MET h:5035 , LEU h:5037 , PHE h:5038 , PHE h:5041 , CLA h:6017 , LEU x:5016 , PHE x:5020BINDING SITE FOR RESIDUE BCR H 6049
130OC4SOFTWARETYR b:5193 , PHE b:5250 , TYR b:5258 , TYR b:5273 , GLN b:5274 , THR b:5452 , ALA b:5456 , LEU b:5460 , PHE b:5463 , CLA b:6010 , GLY d:5086 , HIS d:5087 , LEU d:5116 , VAL d:5154 , ILE d:5159 , LEU d:5162 , SER d:5165 , VAL d:5287 , LEU h:5046 , TYR h:5049 , ASN h:5050 , VAL h:5060 , SER h:5061 , TRP h:5062BINDING SITE FOR RESIDUE DGD B 6058
131OC5SOFTWARESER a:5232 , ASN a:5234 , TRP b:5005 , TYR b:5006 , CLA b:6019 , MGE b:6060 , TRP d:5266 , PHE d:5273 , PQ9 d:6042 , GLU l:5011 , ASN l:5013 , SER l:5016 , GLY l:5020 , LEU l:5022 , VAL l:5026 , VAL m:5017 , PRO m:5018 , PHE m:5021 , LEU m:5022BINDING SITE FOR RESIDUE MGE L 6061
132OC6SOFTWARESER B:36 , CLA B:1015 , BCR B:1047 , PHE t:5008 , ALA t:5011 , ILE t:5014 , PHE t:5018 , ILE t:5021BINDING SITE FOR RESIDUE BCR T 1046
133OC7SOFTWARECYS t:5012BINDING SITE FOR RESIDUE IOD T 6066
134OC8SOFTWAREALA v:5062 , CYS v:5066 , HIS v:5067 , THR v:5074 , LEU v:5078 , LEU v:5085 , TYR v:5101 , TYR v:5108 , ILE v:5114 , HIS v:5118 , ILE v:5145BINDING SITE FOR RESIDUE HEM V 6041
135OC9SOFTWARECLA c:6035 , ALA j:5014 , THR j:5015 , GLY j:5018 , MET j:5019 , ILE k:5028 , LEU k:5031 , ALA k:5034 , LEU k:5035 , PHE k:5037 , VAL k:5038 , BCR k:6052 , ILE y:5028 , GLY y:5029 , GLY y:5032BINDING SITE FOR RESIDUE BCR K 6051

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1O:45 -O:70
2o:5045 -o:5070

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Gly B:173 -Leu B:174
2Thr V:89 -Pro V:90
3Gly b:5173 -Leu b:5174
4Thr v:5089 -Pro v:5090

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3A0H)

(-) PROSITE Motifs  (3, 10)

Asymmetric/Biological Unit (3, 10)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTOCHROME_B559PS00537 Cytochrome b559 subunits heme-binding site signature.PSBE_THEVL14-28
 		  2E:14-28
e:5014-5028
PSBF_THEVL15-29
 		  2F:15-29
f:5015-5029
2CYTCPS51007 Cytochrome c family profile.CY550_THEVL50-149
 		  2V:50-149
v:5050-5149
3REACTION_CENTERPS00244 Photosynthetic reaction center proteins signature.PSBD_THEVL180-206
 		  2D:190-216
d:5190-5216
PSBA_THEVL191-217
 		  2A:191-217
a:5191-5217

(-) Exons   (0, 0)

(no "Exon" information available for 3A0H)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:335
 aligned with PSBA_THEVL | P51765 from UniProtKB/Swiss-Prot  Length:360

    Alignment length:335
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339     
          PSBA_THEVL     10 SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWRVVGVWFAALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA  344
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh...............hhhhh..........................hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh.hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhh..........hhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee................eehhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0h A   10 SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWRVVGVWFAALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA  344
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339     


Chain B from PDB  Type:PROTEIN  Length:488
 aligned with PSBB_THEVL | D0VWR1 from UniProtKB/Swiss-Prot  Length:505

    Alignment length:488
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480        
          PSBB_THEVL      1 GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPE  488
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhh...hhhhhhhh...ee...ee.............hhhhhhhhhhhhhhhhhhhhhh.....hhhhh............hhhhhhhhhhhhhhhhhhh..........eee........eee......hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhh.....hhhhhhh..hhhhhhhhhhhhhhhhh.......hhhhhheeeee..eeeee.....eeee............eeee....eeee.................eeeee.......ee.hhhhhhhhhhh......eeee............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0h B    2 GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPE  489
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481        


Chain C from PDB  Type:PROTEIN  Length:447
 aligned with PSBC_THEVL | D0VWR7 from UniProtKB/Swiss-Prot  Length:451

    Alignment length:447
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       
          PSBC_THEVL      5 DQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD  451
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3a0hC02 C:304-399 photosystem ii from thermosynechococcus elongatus                             -------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh......hhhhh...hhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhh...................hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee.......eee.......hhhhhhhhhhh................hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhhh.................eee.....eee..hhhhhh................hhhhhhhh.hhhhhhhhhhhhhh...ee.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0h C   27 DQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD  473
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       


Chain D from PDB  Type:PROTEIN  Length:340
 aligned with PSBD_THEVL | D0VWR8 from UniProtKB/Swiss-Prot  Length:342

    Alignment length:340
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342
          PSBD_THEVL      3 GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL  342
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhh..hhhhhhee.hhhhh...............................hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0h D   13 GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL  352
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352


Chain E from PDB  Type:PROTEIN  Length:82
 aligned with PSBE_THEVL | P12238 from UniProtKB/Swiss-Prot  Length:84

    Alignment length:82
                                    12        22        32        42        52        62        72        82  
          PSBE_THEVL      3 GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK   84
               SCOP domains ---------------------------------------------------------------------------------- SCOP domains
               CATH domains 3a0hE00 E:3-84 Photosystem q(b) protein helix                                      CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh...............hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------CYTOCHROME_B559-------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                3a0h E    3 GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK   84
                                    12        22        32        42        52        62        72        82  


Chain F from PDB  Type:PROTEIN  Length:35
 aligned with PSBF_THEVL | P12239 from UniProtKB/Swiss-Prot  Length:45

    Alignment length:35
                                    20        30        40     
          PSBF_THEVL     11 VSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR   45
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                PROSITE (2) ----CYTOCHROME_B559---------------- PROSITE (2)
                 Transcript ----------------------------------- Transcript
                3a0h F   11 VSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR   45
                                    20        30        40     


Chain H from PDB  Type:PROTEIN  Length:64
 aligned with PSBH_THEVL | P19052 from UniProtKB/Swiss-Prot  Length:65

    Alignment length:64
                                    10        20        30        40        50        60    
          PSBH_THEVL      1 ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL   64
               SCOP domains ---------------------------------------------------------------- SCOP domains
               CATH domains 3a0hH01 H:2-52                                     ------------- CATH domains
               Pfam domains ---------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------- Transcript
                3a0h H    2 ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL   65
                                    11        21        31        41        51        61    


Chain I from PDB  Type:PROTEIN  Length:35
 aligned with PSBI_THEVL | P12240 from UniProtKB/Swiss-Prot  Length:38

    Alignment length:35
                                    10        20        30     
          PSBI_THEVL      1 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK   35
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------- PROSITE
                 Transcript ----------------------------------- Transcript
                3a0h I    1 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK   35
                                    10        20        30     


Chain J from PDB  Type:PROTEIN  Length:34
 aligned with PSBJ_THEVL | Q7DGD4 from UniProtKB/Swiss-Prot  Length:40

    Alignment length:34
                                    16        26        36    
          PSBJ_THEVL      7 RIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL   40
               SCOP domains ---------------------------------- SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains ---------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------- PROSITE
                 Transcript ---------------------------------- Transcript
                3a0h J    7 RIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL   40
                                    16        26        36    


Chain K from PDB  Type:PROTEIN  Length:36
 aligned with PSBK_THEVL | P19054 from UniProtKB/Swiss-Prot  Length:37

    Alignment length:36
                                    10        20        30      
          PSBK_THEVL      1 KLPEAYAIFDPLVDVLPVIPVLFFALAFVVQAAVGF   36
               SCOP domains ------------------------------------ SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
                 Transcript ------------------------------------ Transcript
                3a0h K   10 KLPEAYAIFDPLVDVLPVIPVLFFALAFVVQAAVGF   45
                                    19        29        39      


Chain L from PDB  Type:PROTEIN  Length:37
 aligned with PSBL_THEVL | P12241 from UniProtKB/Swiss-Prot  Length:37

    Alignment length:37
                                    10        20        30       
          PSBL_THEVL      1 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN   37
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                3a0h L    1 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN   37
                                    10        20        30       


Chain M from PDB  Type:PROTEIN  Length:36
 aligned with PSBM_THEVL | P12312 from UniProtKB/Swiss-Prot  Length:36

    Alignment length:36
                                    10        20        30      
          PSBM_THEVL      1 MEVNQLGFIATALFVLVPSVFLIILYVQTESQQKSS   36
               SCOP domains ------------------------------------ SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
                 Transcript ------------------------------------ Transcript
                3a0h M    1 MEVNQLGFIATALFVLVPSVFLIILYVQTESQQKSS   36
                                    10        20        30      


Chain N from PDB  Type:PROTEIN  Length:23
                                                        
               SCOP domains ----------------------- SCOP domains
               CATH domains ----------------------- CATH domains
               Pfam domains ----------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------- SAPs(SNPs)
                    PROSITE ----------------------- PROSITE
                 Transcript ----------------------- Transcript
                3a0h N    1 xxxxxxxxxxxxxxxxxxxxxxx   23
                            ||||||||10||||||||20|||
                            1-UNK|||10-UNK|||19-UNK
                             2-UNK|||11-UNK|||20-UNK
                              3-UNK|| 12-UNK|| 21-UNK
                               4-UNK|  13-UNK|  22-UNK
                                5-UNK   14-UNK   23-UNK
                                 6-UNK   15-UNK    
                                  7-UNK   16-UNK   
                                   8-UNK   17-UNK  
                                    9-UNK   18-UNK 


Chain O from PDB  Type:PROTEIN  Length:242
 aligned with PSBO_THEVL | D0VWR2 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:242
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241  
          PSBO_THEVL      2 TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP  243
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------3a0hO01 O:50-178,O:215-271 Photosystem II, cytochrome c-550 precursor                                                            3a0hO02 O:179-214                   3a0hO01 O:50-178,O:215-271                                CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..................ee.......eeeeeee...eeeeee.........eeee.ee.......eeeeeeeeeee...eeeee......eeeeeee.....eeeeeee....eee......ee....eeeee............hhhhh..................................eeeeeeee......eeeeeeeeee...........eeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0h O   30 TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP  271
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269  


Chain T from PDB  Type:PROTEIN  Length:30
 aligned with PSBT_THEVL | P12313 from UniProtKB/Swiss-Prot  Length:32

    Alignment length:30
                                    10        20        30
          PSBT_THEVL      1 METITYVFIFACIIALFFFAIFFREPPRIT   30
               SCOP domains ------------------------------ SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains ------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                3a0h T    1 METITYVFIFACIIALFFFAIFFREPPRIT   30
                                    10        20        30


Chain U from PDB  Type:PROTEIN  Length:98
 aligned with PSBU_THEVL | P56152 from UniProtKB/Swiss-Prot  Length:104

    Alignment length:98
                                    16        26        36        46        56        66        76        86        96        
          PSBU_THEVL      7 EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK  104
               SCOP domains -------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3a0hU01 U:7-93 Photosystem II 12 kDa extrinsic protein                                 ----------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhh.hhhhh.ee....hhhhhh.......hhhhhhhh................hhhhhhhhhhhh..ee....hhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                3a0h U    7 EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK  104
                                    16        26        36        46        56        66        76        86        96        


Chain V from PDB  Type:PROTEIN  Length:137
 aligned with CY550_THEVL | P0A387 from UniProtKB/Swiss-Prot  Length:163

    Alignment length:137
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       
         CY550_THEVL     27 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY  163
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3a0hV00 V:27-163 Cytochrome c                                                                                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhh............hhhhhhhhhhhhhhh..................hhhhhhhh.......hhhhhhhhh......................hhhhh..hhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------CYTC  PDB: V:50-149 UniProt: 50-149                                                                 -------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0h V   27 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY  163
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       


Chain X from PDB  Type:PROTEIN  Length:34
 aligned with PSBX_THEVL | D0VWR4 from UniProtKB/Swiss-Prot  Length:40

    Alignment length:34
                                    10        20        30    
          PSBX_THEVL      1 TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQID   34
               SCOP domains ---------------------------------- SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains ---------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------- PROSITE
                 Transcript ---------------------------------- Transcript
                3a0h X   11 TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQID   44
                                    20        30        40    


Chain Y from PDB  Type:PROTEIN  Length:28
 aligned with YCF12_THEVL | D0VWR3 from UniProtKB/Swiss-Prot  Length:30

    Alignment length:28
                                    12        22        
         YCF12_THEVL      3 IAQLTMIAMIGIAGPMIIFLLAVRRGNL   30
               SCOP domains ---------------------------- SCOP domains
               CATH domains ---------------------------- CATH domains
               Pfam domains ---------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------- SAPs(SNPs)
                    PROSITE ---------------------------- PROSITE
                 Transcript ---------------------------- Transcript
                3a0h Y   19 IAQLTMIAMIGIAGPMIIFLLAVRRGNL   46
                                    28        38        


Chain Z from PDB  Type:PROTEIN  Length:62
 aligned with PSBZ_THEVL | D0VWR5 from UniProtKB/Swiss-Prot  Length:62

    Alignment length:62
                                    10        20        30        40        50        60  
          PSBZ_THEVL      1 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV   62
               SCOP domains -------------------------------------------------------------- SCOP domains
               CATH domains 3a0hZ00 Z:1-62 Helix hairpin bin                               CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                3a0h Z    1 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV   62
                                    10        20        30        40        50        60  


Chain a from PDB  Type:PROTEIN  Length:335
 aligned with PSBA_THEVL | P51765 from UniProtKB/Swiss-Prot  Length:360

    Alignment length:335
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339     
          PSBA_THEVL     10 SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWRVVGVWFAALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA  344
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh...............hhhhh..........................hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh.hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhh..........hhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee................eehhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0h a 5010 SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWRVVGVWFAALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA 5344
                                  5019      5029      5039      5049      5059      5069      5079      5089      5099      5109      5119      5129      5139      5149      5159      5169      5179      5189      5199      5209      5219      5229      5239      5249      5259      5269      5279      5289      5299      5309      5319      5329      5339     


Chain b from PDB  Type:PROTEIN  Length:488
 aligned with PSBB_THEVL | D0VWR1 from UniProtKB/Swiss-Prot  Length:505

    Alignment length:488
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480        
          PSBB_THEVL      1 GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPE  488
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhh...hhhhhhhh...ee...ee.............hhhhhhhhhhhhhhhhhhhhhh.....hhhhh............hhhhhhhhhhhhhhhhhhh..........eee........eee......hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhh.....hhhhhhh..hhhhhhhhhhhhhhhhh.......hhhhhheeeee..eeeee.....eeee............eeee....eeee.................eeeee.......ee.hhhhhhhhhhh......eeee............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0h b 5002 GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPE 5489
                                  5011      5021      5031      5041      5051      5061      5071      5081      5091      5101      5111      5121      5131      5141      5151      5161      5171      5181      5191      5201      5211      5221      5231      5241      5251      5261      5271      5281      5291      5301      5311      5321      5331      5341      5351      5361      5371      5381      5391      5401      5411      5421      5431      5441      5451      5461      5471      5481        


Chain c from PDB  Type:PROTEIN  Length:447
 aligned with PSBC_THEVL | D0VWR7 from UniProtKB/Swiss-Prot  Length:451

    Alignment length:447
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       
          PSBC_THEVL      5 DQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD  451
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3a0hc02 c:5304-5399 photosystem ii from thermosynechococcus elongatus                           -------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh......hhhhh...hhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhh...................hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee.......eee.......hhhhhhhhhhh................hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhhh.................eee.....eee..hhhhhh................hhhhhhhh.hhhhhhhhhhhhhh...ee.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0h c 5027 DQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD 5473
                                  5036      5046      5056      5066      5076      5086      5096      5106      5116      5126      5136      5146      5156      5166      5176      5186      5196      5206      5216      5226      5236      5246      5256      5266      5276      5286      5296      5306      5316      5326      5336      5346      5356      5366      5376      5386      5396      5406      5416      5426      5436      5446      5456      5466       


Chain d from PDB  Type:PROTEIN  Length:340
 aligned with PSBD_THEVL | D0VWR8 from UniProtKB/Swiss-Prot  Length:342

    Alignment length:340
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342
          PSBD_THEVL      3 GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL  342
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhh..hhhhhhee.hhhhh...............................hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0h d 5013 GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL 5352
                                  5022      5032      5042      5052      5062      5072      5082      5092      5102      5112      5122      5132      5142      5152      5162      5172      5182      5192      5202      5212      5222      5232      5242      5252      5262      5272      5282      5292      5302      5312      5322      5332      5342      5352


Chain e from PDB  Type:PROTEIN  Length:82
 aligned with PSBE_THEVL | P12238 from UniProtKB/Swiss-Prot  Length:84

    Alignment length:82
                                    12        22        32        42        52        62        72        82  
          PSBE_THEVL      3 GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK   84
               SCOP domains ---------------------------------------------------------------------------------- SCOP domains
               CATH domains 3a0he00 e:5003-5084 Photosystem q(b) protein helix                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh...............hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------CYTOCHROME_B559-------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                3a0h e 5003 GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK 5084
                                  5012      5022      5032      5042      5052      5062      5072      5082  


Chain f from PDB  Type:PROTEIN  Length:35
 aligned with PSBF_THEVL | P12239 from UniProtKB/Swiss-Prot  Length:45

    Alignment length:35
                                    20        30        40     
          PSBF_THEVL     11 VSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR   45
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                PROSITE (2) ----CYTOCHROME_B559---------------- PROSITE (2)
                 Transcript ----------------------------------- Transcript
                3a0h f 5011 VSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR 5045
                                  5020      5030      5040     


Chain h from PDB  Type:PROTEIN  Length:64
 aligned with PSBH_THEVL | P19052 from UniProtKB/Swiss-Prot  Length:65

    Alignment length:64
                                    10        20        30        40        50        60    
          PSBH_THEVL      1 ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL   64
               SCOP domains ---------------------------------------------------------------- SCOP domains
               CATH domains 3a0hh01 h:5002-5052                                ------------- CATH domains
               Pfam domains ---------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------- Transcript
                3a0h h 5002 ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL 5065
                                  5011      5021      5031      5041      5051      5061    


Chain i from PDB  Type:PROTEIN  Length:35
 aligned with PSBI_THEVL | P12240 from UniProtKB/Swiss-Prot  Length:38

    Alignment length:35
                                    10        20        30     
          PSBI_THEVL      1 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK   35
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------- PROSITE
                 Transcript ----------------------------------- Transcript
                3a0h i 5001 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK 5035
                                  5010      5020      5030     


Chain j from PDB  Type:PROTEIN  Length:34
 aligned with PSBJ_THEVL | Q7DGD4 from UniProtKB/Swiss-Prot  Length:40

    Alignment length:34
                                    16        26        36    
          PSBJ_THEVL      7 RIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL   40
               SCOP domains ---------------------------------- SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains ---------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------- PROSITE
                 Transcript ---------------------------------- Transcript
                3a0h j 5007 RIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL 5040
                                  5016      5026      5036    


Chain k from PDB  Type:PROTEIN  Length:36
 aligned with PSBK_THEVL | P19054 from UniProtKB/Swiss-Prot  Length:37

    Alignment length:36
                                    10        20        30      
          PSBK_THEVL      1 KLPEAYAIFDPLVDVLPVIPVLFFALAFVVQAAVGF   36
               SCOP domains ------------------------------------ SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
                 Transcript ------------------------------------ Transcript
                3a0h k 5010 KLPEAYAIFDPLVDVLPVIPVLFFALAFVVQAAVGF 5045
                                  5019      5029      5039      


Chain l from PDB  Type:PROTEIN  Length:37
 aligned with PSBL_THEVL | P12241 from UniProtKB/Swiss-Prot  Length:37

    Alignment length:37
                                    10        20        30       
          PSBL_THEVL      1 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN   37
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                3a0h l 5001 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN 5037
                                  5010      5020      5030       


Chain m from PDB  Type:PROTEIN  Length:36
 aligned with PSBM_THEVL | P12312 from UniProtKB/Swiss-Prot  Length:36

    Alignment length:36
                                    10        20        30      
          PSBM_THEVL      1 MEVNQLGFIATALFVLVPSVFLIILYVQTESQQKSS   36
               SCOP domains ------------------------------------ SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
                 Transcript ------------------------------------ Transcript
                3a0h m 5001 MEVNQLGFIATALFVLVPSVFLIILYVQTESQQKSS 5036
                                  5010      5020      5030      


Chain n from PDB  Type:PROTEIN  Length:23
                                                        
               SCOP domains ----------------------- SCOP domains
               CATH domains ----------------------- CATH domains
               Pfam domains ----------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------- SAPs(SNPs)
                    PROSITE ----------------------- PROSITE
                 Transcript ----------------------- Transcript
                3a0h n 5001 xxxxxxxxxxxxxxxxxxxxxxx 5023
                            ||||||5010||||||5020|||
                            |||||5009-UNK|5018-UNK|
                         5001-UNK|5010-UNK|5019-UNK
                          5002-UNK|5011-UNK|5020-UNK
                           5003-UNK|5012-UNK|5021-UNK
                            5004-UNK 5013-UNK 5022-UNK
                             5005-UNK 5014-UNK 5023-UNK
                              5006-UNK 5015-UNK    
                               5007-UNK 5016-UNK   
                                5008-UNK 5017-UNK  


Chain o from PDB  Type:PROTEIN  Length:242
 aligned with PSBO_THEVL | D0VWR2 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:242
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241  
          PSBO_THEVL      2 TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP  243
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------3a0ho01 o:5050-5178,o:5215-5271 Photosystem II, cytochrome c-550 precursor                                                       3a0ho02 o:5179-5214                 3a0ho01 o:5050-5178,o:5215-5271                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..................ee.......eeeeeee...eeeeee.........eeee.ee.......eeeeeeeeeee...eeeee......eeeeeee.....eeeeeee....eee......ee....eeeee............hhhhh..................................eeeeeeee......eeeeeeeeee...........eeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0h o 5030 TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP 5271
                                  5039      5049      5059      5069      5079      5089      5099      5109      5119      5129      5139      5149      5159      5169      5179      5189      5199      5209      5219      5229      5239      5249      5259      5269  


Chain t from PDB  Type:PROTEIN  Length:30
 aligned with PSBT_THEVL | P12313 from UniProtKB/Swiss-Prot  Length:32

    Alignment length:30
                                    10        20        30
          PSBT_THEVL      1 METITYVFIFACIIALFFFAIFFREPPRIT   30
               SCOP domains ------------------------------ SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains ------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                3a0h t 5001 METITYVFIFACIIALFFFAIFFREPPRIT 5030
                                  5010      5020      5030


Chain u from PDB  Type:PROTEIN  Length:98
 aligned with PSBU_THEVL | P56152 from UniProtKB/Swiss-Prot  Length:104

    Alignment length:98
                                    16        26        36        46        56        66        76        86        96        
          PSBU_THEVL      7 EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK  104
               SCOP domains -------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3a0hu01 u:5007-5093 Photosystem II 12 kDa extrinsic protein                            ----------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhh.hhhhh.ee....hhhhhh.......hhhhhhhh................hhhhhhhhhhhh..ee....hhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                3a0h u 5007 EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK 5104
                                  5016      5026      5036      5046      5056      5066      5076      5086      5096        


Chain v from PDB  Type:PROTEIN  Length:137
 aligned with CY550_THEVL | P0A387 from UniProtKB/Swiss-Prot  Length:163

    Alignment length:137
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       
         CY550_THEVL     27 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY  163
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3a0hv00 v:5027-5163 Cytochrome c                                                                                                          CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhh............hhhhhhhhhhhhhhh..................hhhhhhhh.......hhhhhhhhh......................hhhhh..hhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------CYTC  PDB: v:5050-5149 UniProt: 50-149                                                              -------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0h v 5027 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY 5163
                                  5036      5046      5056      5066      5076      5086      5096      5106      5116      5126      5136      5146      5156       


Chain x from PDB  Type:PROTEIN  Length:34
 aligned with PSBX_THEVL | D0VWR4 from UniProtKB/Swiss-Prot  Length:40

    Alignment length:34
                                    10        20        30    
          PSBX_THEVL      1 TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQID   34
               SCOP domains ---------------------------------- SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains ---------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------- PROSITE
                 Transcript ---------------------------------- Transcript
                3a0h x 5011 TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQID 5044
                                  5020      5030      5040    


Chain y from PDB  Type:PROTEIN  Length:28
 aligned with YCF12_THEVL | D0VWR3 from UniProtKB/Swiss-Prot  Length:30

    Alignment length:28
                                    12        22        
         YCF12_THEVL      3 IAQLTMIAMIGIAGPMIIFLLAVRRGNL   30
               SCOP domains ---------------------------- SCOP domains
               CATH domains ---------------------------- CATH domains
               Pfam domains ---------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------- SAPs(SNPs)
                    PROSITE ---------------------------- PROSITE
                 Transcript ---------------------------- Transcript
                3a0h y 5019 IAQLTMIAMIGIAGPMIIFLLAVRRGNL 5046
                                  5028      5038        


Chain z from PDB  Type:PROTEIN  Length:62
 aligned with PSBZ_THEVL | D0VWR5 from UniProtKB/Swiss-Prot  Length:62

    Alignment length:62
                                    10        20        30        40        50        60  
          PSBZ_THEVL      1 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV   62
               SCOP domains -------------------------------------------------------------- SCOP domains
               CATH domains 3a0hz00 z:5001-5062 Helix hairpin bin                          CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                3a0h z 5001 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV 5062
                                  5010      5020      5030      5040      5050      5060
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3A0H)

(-) CATH Domains  (8, 16)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Alpha (13335)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3A0H)

(-) Gene Ontology  (30, 190)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,a   (PSBA_THEVL | P51765)
molecular function
    GO:0016168    chlorophyll binding    Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0045156    electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity    Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0010242    oxygen evolving activity    Catalysis of the reaction: 2 H2O = O2 + 4 H+ + 4 e-. The evolution of oxygen from oxidizing water is carried out by the oxygen evolving complex in photosystem II of plants. P680+, the photochemically oxidized reaction-center chlorophyll of PSII, is a strong biological oxidant. The reduction potential of P680+ is more positive than that of water, and thus it can oxidize water to give O2 and H+ ions. The oxygen escapes as a gas while the H+ ions remain in solution inside the thylakoid vesicle.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0019684    photosynthesis, light reaction    The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
    GO:0009772    photosynthetic electron transport in photosystem II    A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
    GO:0009635    response to herbicide    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a herbicide stimulus. Herbicides are chemicals used to kill or control the growth of plants.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain B,b   (PSBB_THEVL | D0VWR1)
molecular function
    GO:0016168    chlorophyll binding    Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
    GO:0045156    electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity    Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0019684    photosynthesis, light reaction    The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
    GO:0009767    photosynthetic electron transport chain    A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
    GO:0009772    photosynthetic electron transport in photosystem II    A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009521    photosystem    A complex located in a photosynthetic membrane that consists of a photoreaction center associated with accessory pigments and electron carriers. Examples of this component are found in Arabidopsis thaliana and in photosynthetic bacterial and archaeal species.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain C,c   (PSBC_THEVL | D0VWR7)
molecular function
    GO:0016168    chlorophyll binding    Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
    GO:0045156    electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity    Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0019684    photosynthesis, light reaction    The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
    GO:0009767    photosynthetic electron transport chain    A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
    GO:0009772    photosynthetic electron transport in photosystem II    A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009521    photosystem    A complex located in a photosynthetic membrane that consists of a photoreaction center associated with accessory pigments and electron carriers. Examples of this component are found in Arabidopsis thaliana and in photosynthetic bacterial and archaeal species.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain D,d   (PSBD_THEVL | D0VWR8)
molecular function
    GO:0016168    chlorophyll binding    Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
    GO:0045156    electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity    Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0019684    photosynthesis, light reaction    The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
    GO:0009772    photosynthetic electron transport in photosystem II    A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain E,e   (PSBE_THEVL | P12238)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0019684    photosynthesis, light reaction    The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
    GO:0009767    photosynthetic electron transport chain    A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009539    photosystem II reaction center    An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain F,f   (PSBF_THEVL | P12239)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0019684    photosynthesis, light reaction    The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
    GO:0009767    photosynthetic electron transport chain    A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009539    photosystem II reaction center    An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain H,h   (PSBH_THEVL | P19052)
molecular function
    GO:0042301    phosphate ion binding    Interacting selectively and non-covalently with phosphate.
biological process
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0050821    protein stabilization    Any process involved in maintaining the structure and integrity of a protein and preventing it from degradation or aggregation.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain I,i   (PSBI_THEVL | P12240)
biological process
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009539    photosystem II reaction center    An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain J,j   (PSBJ_THEVL | Q7DGD4)
biological process
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009539    photosystem II reaction center    An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain K,k   (PSBK_THEVL | P19054)
biological process
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009539    photosystem II reaction center    An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain L,l   (PSBL_THEVL | P12241)
biological process
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009539    photosystem II reaction center    An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain M,m   (PSBM_THEVL | P12312)
biological process
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0019684    photosynthesis, light reaction    The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain O,o   (PSBO_THEVL | D0VWR2)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
biological process
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0042549    photosystem II stabilization    The stabilization of the photosystem II protein complex, resulting from the phosphorylation of its structural protein subunits, in a cell actively involved in photosynthesis.
cellular component
    GO:0019898    extrinsic component of membrane    The component of a membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009654    photosystem II oxygen evolving complex    A complex, composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins, that catalyzes the splitting of water to O2 and 4 H+. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ).
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain T,t   (PSBT_THEVL | P12313)
biological process
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009539    photosystem II reaction center    An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain U,u   (PSBU_THEVL | P56152)
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0042549    photosystem II stabilization    The stabilization of the photosystem II protein complex, resulting from the phosphorylation of its structural protein subunits, in a cell actively involved in photosynthesis.
cellular component
    GO:0019898    extrinsic component of membrane    The component of a membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009654    photosystem II oxygen evolving complex    A complex, composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins, that catalyzes the splitting of water to O2 and 4 H+. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ).
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain V,v   (CY550_THEVL | P0A387)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0018063    cytochrome c-heme linkage    The linkage of cytochromes and other heme proteins to heme.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0019684    photosynthesis, light reaction    The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
    GO:0022904    respiratory electron transport chain    A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain X,x   (PSBX_THEVL | D0VWR4)
biological process
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain Y,y   (YCF12_THEVL | D0VWR3)
biological process
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain Z,z   (PSBZ_THEVL | D0VWR5)
biological process
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0042549    photosystem II stabilization    The stabilization of the photosystem II protein complex, resulting from the phosphorylation of its structural protein subunits, in a cell actively involved in photosynthesis.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0009523    photosystem II    A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
    GO:0009539    photosystem II reaction center    An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BCR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CLA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DGD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FE2  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IOD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    LHG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MGE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OEC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PHO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PQ9  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UNK  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
    DC4  [ RasMol ]  +environment [ RasMol ]
    DC5  [ RasMol ]  +environment [ RasMol ]
    DC6  [ RasMol ]  +environment [ RasMol ]
    DC7  [ RasMol ]  +environment [ RasMol ]
    DC8  [ RasMol ]  +environment [ RasMol ]
    DC9  [ RasMol ]  +environment [ RasMol ]
    EC1  [ RasMol ]  +environment [ RasMol ]
    EC2  [ RasMol ]  +environment [ RasMol ]
    EC3  [ RasMol ]  +environment [ RasMol ]
    EC4  [ RasMol ]  +environment [ RasMol ]
    EC5  [ RasMol ]  +environment [ RasMol ]
    EC6  [ RasMol ]  +environment [ RasMol ]
    EC7  [ RasMol ]  +environment [ RasMol ]
    EC8  [ RasMol ]  +environment [ RasMol ]
    EC9  [ RasMol ]  +environment [ RasMol ]
    FC1  [ RasMol ]  +environment [ RasMol ]
    FC2  [ RasMol ]  +environment [ RasMol ]
    FC3  [ RasMol ]  +environment [ RasMol ]
    FC4  [ RasMol ]  +environment [ RasMol ]
    FC5  [ RasMol ]  +environment [ RasMol ]
    FC6  [ RasMol ]  +environment [ RasMol ]
    FC7  [ RasMol ]  +environment [ RasMol ]
    FC8  [ RasMol ]  +environment [ RasMol ]
    FC9  [ RasMol ]  +environment [ RasMol ]
    GC1  [ RasMol ]  +environment [ RasMol ]
    GC2  [ RasMol ]  +environment [ RasMol ]
    GC3  [ RasMol ]  +environment [ RasMol ]
    GC4  [ RasMol ]  +environment [ RasMol ]
    GC5  [ RasMol ]  +environment [ RasMol ]
    GC6  [ RasMol ]  +environment [ RasMol ]
    GC7  [ RasMol ]  +environment [ RasMol ]
    GC8  [ RasMol ]  +environment [ RasMol ]
    GC9  [ RasMol ]  +environment [ RasMol ]
    HC1  [ RasMol ]  +environment [ RasMol ]
    HC2  [ RasMol ]  +environment [ RasMol ]
    HC3  [ RasMol ]  +environment [ RasMol ]
    HC4  [ RasMol ]  +environment [ RasMol ]
    HC5  [ RasMol ]  +environment [ RasMol ]
    HC6  [ RasMol ]  +environment [ RasMol ]
    HC7  [ RasMol ]  +environment [ RasMol ]
    HC8  [ RasMol ]  +environment [ RasMol ]
    HC9  [ RasMol ]  +environment [ RasMol ]
    IC1  [ RasMol ]  +environment [ RasMol ]
    IC2  [ RasMol ]  +environment [ RasMol ]
    IC3  [ RasMol ]  +environment [ RasMol ]
    IC4  [ RasMol ]  +environment [ RasMol ]
    IC5  [ RasMol ]  +environment [ RasMol ]
    IC6  [ RasMol ]  +environment [ RasMol ]
    IC7  [ RasMol ]  +environment [ RasMol ]
    IC8  [ RasMol ]  +environment [ RasMol ]
    IC9  [ RasMol ]  +environment [ RasMol ]
    JC1  [ RasMol ]  +environment [ RasMol ]
    JC2  [ RasMol ]  +environment [ RasMol ]
    JC3  [ RasMol ]  +environment [ RasMol ]
    JC4  [ RasMol ]  +environment [ RasMol ]
    JC5  [ RasMol ]  +environment [ RasMol ]
    JC6  [ RasMol ]  +environment [ RasMol ]
    JC7  [ RasMol ]  +environment [ RasMol ]
    JC8  [ RasMol ]  +environment [ RasMol ]
    JC9  [ RasMol ]  +environment [ RasMol ]
    KC1  [ RasMol ]  +environment [ RasMol ]
    KC2  [ RasMol ]  +environment [ RasMol ]
    KC3  [ RasMol ]  +environment [ RasMol ]
    KC4  [ RasMol ]  +environment [ RasMol ]
    KC5  [ RasMol ]  +environment [ RasMol ]
    KC6  [ RasMol ]  +environment [ RasMol ]
    KC7  [ RasMol ]  +environment [ RasMol ]
    KC8  [ RasMol ]  +environment [ RasMol ]
    KC9  [ RasMol ]  +environment [ RasMol ]
    LC1  [ RasMol ]  +environment [ RasMol ]
    LC2  [ RasMol ]  +environment [ RasMol ]
    LC3  [ RasMol ]  +environment [ RasMol ]
    LC4  [ RasMol ]  +environment [ RasMol ]
    LC5  [ RasMol ]  +environment [ RasMol ]
    LC6  [ RasMol ]  +environment [ RasMol ]
    LC7  [ RasMol ]  +environment [ RasMol ]
    LC8  [ RasMol ]  +environment [ RasMol ]
    LC9  [ RasMol ]  +environment [ RasMol ]
    MC1  [ RasMol ]  +environment [ RasMol ]
    MC2  [ RasMol ]  +environment [ RasMol ]
    MC3  [ RasMol ]  +environment [ RasMol ]
    MC4  [ RasMol ]  +environment [ RasMol ]
    MC5  [ RasMol ]  +environment [ RasMol ]
    MC6  [ RasMol ]  +environment [ RasMol ]
    MC7  [ RasMol ]  +environment [ RasMol ]
    MC8  [ RasMol ]  +environment [ RasMol ]
    MC9  [ RasMol ]  +environment [ RasMol ]
    NC1  [ RasMol ]  +environment [ RasMol ]
    NC2  [ RasMol ]  +environment [ RasMol ]
    NC3  [ RasMol ]  +environment [ RasMol ]
    NC4  [ RasMol ]  +environment [ RasMol ]
    NC5  [ RasMol ]  +environment [ RasMol ]
    NC6  [ RasMol ]  +environment [ RasMol ]
    NC7  [ RasMol ]  +environment [ RasMol ]
    NC8  [ RasMol ]  +environment [ RasMol ]
    NC9  [ RasMol ]  +environment [ RasMol ]
    OC1  [ RasMol ]  +environment [ RasMol ]
    OC2  [ RasMol ]  +environment [ RasMol ]
    OC3  [ RasMol ]  +environment [ RasMol ]
    OC4  [ RasMol ]  +environment [ RasMol ]
    OC5  [ RasMol ]  +environment [ RasMol ]
    OC6  [ RasMol ]  +environment [ RasMol ]
    OC7  [ RasMol ]  +environment [ RasMol ]
    OC8  [ RasMol ]  +environment [ RasMol ]
    OC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly B:173 - Leu B:174   [ RasMol ]  
    Gly b:5173 - Leu b:5174   [ RasMol ]  
    Thr V:89 - Pro V:90   [ RasMol ]  
    Thr v:5089 - Pro v:5090   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3a0h
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CY550_THEVL | P0A387
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBA_THEVL | P51765
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBB_THEVL | D0VWR1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBC_THEVL | D0VWR7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBD_THEVL | D0VWR8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBE_THEVL | P12238
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBF_THEVL | P12239
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBH_THEVL | P19052
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBI_THEVL | P12240
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBJ_THEVL | Q7DGD4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBK_THEVL | P19054
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBL_THEVL | P12241
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBM_THEVL | P12312
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBO_THEVL | D0VWR2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBT_THEVL | P12313
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBU_THEVL | P56152
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBX_THEVL | D0VWR4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBZ_THEVL | D0VWR5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  YCF12_THEVL | D0VWR3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CY550_THEVL | P0A387
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBA_THEVL | P51765
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBB_THEVL | D0VWR1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBC_THEVL | D0VWR7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBD_THEVL | D0VWR8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBE_THEVL | P12238
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBF_THEVL | P12239
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBH_THEVL | P19052
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBI_THEVL | P12240
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBJ_THEVL | Q7DGD4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBK_THEVL | P19054
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBL_THEVL | P12241
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBM_THEVL | P12312
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBO_THEVL | D0VWR2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBT_THEVL | P12313
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBU_THEVL | P56152
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBX_THEVL | D0VWR4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBZ_THEVL | D0VWR5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  YCF12_THEVL | D0VWR3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CY550_THEVL | P0A387: 1izl 1w5c 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        PSBA_THEVL | P51765: 1izl 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        PSBB_THEVL | D0VWR1: 1izl 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        PSBC_THEVL | D0VWR7: 1izl 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        PSBD_THEVL | D0VWR8: 1izl 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        PSBE_THEVL | P12238: 1izl 1w5c 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        PSBF_THEVL | P12239: 1izl 1w5c 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        PSBH_THEVL | P19052: 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        PSBI_THEVL | P12240: 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        PSBJ_THEVL | Q7DGD4: 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        PSBK_THEVL | P19054: 1izl 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        PSBL_THEVL | P12241: 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        PSBM_THEVL | P12312: 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        PSBO_THEVL | D0VWR2: 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        PSBT_THEVL | P12313: 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        PSBU_THEVL | P56152: 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        PSBX_THEVL | D0VWR4: 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        PSBZ_THEVL | D0VWR5: 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6
        YCF12_THEVL | D0VWR3: 3a0b 3wu2 4il6 4ub6 4ub8 5b5e 5b66 5gth 5gti 5ws5 5ws6

(-) Related Entries Specified in the PDB File

3a0b THE PHOTOSYSTEM II COMPLEX SUBMITED WITH BROMIDE ION