3A0B - JenaLib

Asymmetric Unit (130, 130)

No.	Name	Evidence	Residues	Description
001	AC1	SOFTWARE	ASP A:61 , ASP A:170 , GLU A:189 , HIS A:332 , GLU A:333 , ASP A:342 , ALA A:344 , GLU C:354	BINDING SITE FOR RESIDUE OEC A 1001
002	AC2	SOFTWARE	HIS A:215 , HIS A:272 , HIS D:214 , TYR D:244 , HIS D:268	BINDING SITE FOR RESIDUE FE2 A 1002
003	AC3	SOFTWARE	PHE A:119 , PRO A:150 , SER A:153 , ALA A:154 , VAL A:157 , MET A:183 , ILE A:184 , PHE A:186 , GLN A:187 , LEU A:193 , HIS A:198 , GLY A:201 , VAL A:202 , VAL A:205 , PHE A:206 , ALA A:286 , ALA A:287 , ILE A:290 , CLA A:1006 , PHO A:1038 , LEU D:182 , CLA D:1004 , CLA D:1005 , MGE D:1062 , PHE T:17	BINDING SITE FOR RESIDUE CLA A 1003
004	AC4	SOFTWARE	PHE A:206 , CLA A:1003 , CLA A:1006 , PHO A:1039 , PQ9 A:1043 , LEU D:45 , VAL D:152 , VAL D:156 , PHE D:181 , LEU D:182 , PHE D:185 , GLN D:186 , TRP D:191 , HIS D:197 , GLY D:200 , VAL D:201 , VAL D:204 , LEU D:205 , SER D:282 , ALA D:283 , VAL D:286 , CLA D:1005 , MGE J:1059	BINDING SITE FOR RESIDUE CLA D 1004
005	AC5	SOFTWARE	THR A:45 , PHE A:119 , VAL A:157 , PHE A:158 , MET A:172 , ILE A:176 , THR A:179 , MET A:183 , CLA A:1003 , PHO A:1038 , MET D:198 , VAL D:201 , ALA D:202 , LEU D:205 , GLY D:206 , CLA D:1004 , PQ9 D:1042 , MGE D:1062	BINDING SITE FOR RESIDUE CLA D 1005
006	AC6	SOFTWARE	VAL A:202 , ALA A:203 , PHE A:206 , LEU A:210 , CLA A:1003 , PHO A:1039 , PQ9 A:1043 , DGD C:1057 , PHE D:157 , VAL D:175 , ILE D:178 , PHE D:179 , LEU D:182 , CLA D:1004 , BCR D:1050	BINDING SITE FOR RESIDUE CLA A 1006
007	AC7	SOFTWARE	PRO A:39 , THR A:40 , PHE A:93 , PRO A:95 , ILE A:96 , TRP A:97 , LEU A:114 , HIS A:118 , LEU A:121 , BCR A:1044 , TYR I:9 , VAL I:11 , THR I:13 , PHE I:15	BINDING SITE FOR RESIDUE CLA A 1007
008	AC8	SOFTWARE	CLA B:1016 , LEU D:36 , PRO D:39 , CYS D:40 , LEU D:89 , LEU D:90 , LEU D:91 , LEU D:92 , TRP D:93 , THR D:112 , PHE D:113 , LEU D:116 , HIS D:117 , PHE D:120 , BCR D:1050 , MET H:35 , LEU H:43 , LEU X:23 , GLY X:26 , LEU X:30	BINDING SITE FOR RESIDUE CLA D 1008
009	AC9	SOFTWARE	TRP B:185 , PRO B:187 , PHE B:190 , CLA B:1010 , BCR H:1049	BINDING SITE FOR RESIDUE CLA B 1009
010	BC1	SOFTWARE	GLY B:189 , PHE B:190 , GLY B:197 , HIS B:201 , ALA B:204 , ALA B:205 , PHE B:247 , PHE B:250 , VAL B:251 , CLA B:1009 , CLA B:1011 , VAL D:154 , ILE D:159 , LEU H:46 , TYR H:49 , CLA H:1017 , DGD H:1058	BINDING SITE FOR RESIDUE CLA B 1010
011	BC2	SOFTWARE	ARG B:68 , LEU B:69 , ALA B:146 , LEU B:149 , CYS B:150 , HIS B:201 , HIS B:202 , PHE B:247 , ALA B:248 , VAL B:252 , CLA B:1010 , CLA B:1013 , CLA B:1014 , CLA B:1016 , CLA B:1018 , PHE H:38 , LEU H:39 , CLA H:1017 , BCR H:1049	BINDING SITE FOR RESIDUE CLA B 1011
012	BC3	SOFTWARE	TRP B:33 , PHE B:65 , LEU B:148 , LEU B:149 , VAL B:245 , ALA B:249 , VAL B:252 , PHE B:451 , PHE B:458 , PHE B:462 , CLA B:1013 , CLA B:1015 , CLA B:1018 , CLA B:1023 , CLA B:1024	BINDING SITE FOR RESIDUE CLA B 1012
013	BC4	SOFTWARE	THR B:27 , VAL B:30 , ALA B:31 , TRP B:33 , ALA B:34 , VAL B:62 , MET B:66 , LEU B:69 , VAL B:96 , HIS B:100 , ALA B:205 , GLY B:209 , CLA B:1011 , CLA B:1012 , CLA B:1014 , CLA B:1018 , CLA B:1020 , CLA B:1023	BINDING SITE FOR RESIDUE CLA B 1013
014	BC5	SOFTWARE	TRP B:91 , ALA B:99 , VAL B:102 , LEU B:103 , LEU B:149 , CYS B:150 , GLY B:152 , PHE B:153 , PHE B:156 , HIS B:157 , PHE B:162 , GLY B:163 , CLA B:1011 , CLA B:1013 , BCR B:1048	BINDING SITE FOR RESIDUE CLA B 1014
015	BC6	SOFTWARE	TRP B:33 , MET B:37 , TYR B:40 , GLY B:59 , MET B:60 , PHE B:61 , PRO B:329 , TRP B:450 , PHE B:451 , ALA B:454 , CLA B:1012 , BCR B:1045 , BCR B:1047 , MGE B:1060 , LEU L:27 , PHE L:31	BINDING SITE FOR RESIDUE CLA B 1015
016	BC7	SOFTWARE	THR B:236 , SER B:239 , SER B:240 , ALA B:243 , PHE B:246 , PHE B:463 , HIS B:466 , GLY B:470 , THR B:473 , CLA B:1011 , CLA B:1018 , PHE D:120 , ILE D:123 , MET D:126 , LEU D:127 , PHE D:130 , CLA D:1008 , LEU H:46 , CLA H:1017	BINDING SITE FOR RESIDUE CLA B 1016
017	BC8	SOFTWARE	PHE B:139 , ALA B:212 , PHE B:215 , HIS B:216 , PRO B:221 , PRO B:222 , LEU B:225 , CLA B:1010 , CLA B:1011 , CLA B:1016 , CLA B:1018 , THR H:27 , LEU H:30 , MET H:31 , PHE H:34 , MET H:35 , LEU H:39 , BCR H:1049	BINDING SITE FOR RESIDUE CLA H 1017
018	BC9	SOFTWARE	HIS B:23 , LEU B:135 , PRO B:136 , PHE B:139 , HIS B:142 , LEU B:229 , MET B:231 , VAL B:237 , SER B:240 , SER B:241 , CLA B:1011 , CLA B:1012 , CLA B:1013 , CLA B:1016 , CLA B:1020 , CLA B:1023 , CLA H:1017	BINDING SITE FOR RESIDUE CLA B 1018
019	CC1	SOFTWARE	TRP B:5 , TYR B:6 , ARG B:7 , VAL B:8 , HIS B:9 , THR B:10 , LEU B:461 , PHE B:462 , PHE B:464 , GLY B:465 , TRP B:468 , HIS B:469 , CLA B:1020 , CLA B:1021 , MGE B:1060 , MGE L:1061	BINDING SITE FOR RESIDUE CLA B 1019
020	CC2	SOFTWARE	HIS B:9 , HIS B:23 , HIS B:26 , THR B:27 , VAL B:30 , VAL B:237 , LEU B:238 , SER B:241 , CLA B:1013 , CLA B:1018 , CLA B:1019 , CLA B:1021 , CLA B:1022 , CLA B:1023	BINDING SITE FOR RESIDUE CLA B 1020
021	CC3	SOFTWARE	HIS B:26 , VAL B:30 , TRP B:33 , LEU B:461 , PHE B:462 , CLA B:1019 , CLA B:1020 , CLA B:1022 , MGE B:1060 , PHE M:14	BINDING SITE FOR RESIDUE CLA B 1021
022	CC4	SOFTWARE	VAL B:8 , HIS B:9 , ALA B:22 , HIS B:26 , LEU B:29 , CLA B:1020 , CLA B:1021 , BCR B:1045 , ARG L:7 , MGE L:1061 , PHE M:21 , LEU M:25 , SER m:5036	BINDING SITE FOR RESIDUE CLA B 1022
023	CC5	SOFTWARE	ILE B:20 , HIS B:23 , LEU B:133 , MET B:138 , ILE B:141 , HIS B:142 , LEU B:145 , CLA B:1012 , CLA B:1013 , CLA B:1018 , CLA B:1020 , CLA B:1024 , BCR B:1048 , LEU H:7 , LEU H:14	BINDING SITE FOR RESIDUE CLA B 1023
024	CC6	SOFTWARE	LEU B:24 , ALA B:110 , TRP B:113 , HIS B:114 , CLA B:1012 , CLA B:1023 , BCR B:1048 , THR H:5 , LEU H:7 , GLY H:8	BINDING SITE FOR RESIDUE CLA B 1024
025	CC7	SOFTWARE	HIS C:91 , THR C:94 , LEU C:168 , ALA C:172 , LEU C:175 , HIS C:237 , ALA C:278 , MET C:282 , ILE C:285 , PHE C:289 , VAL C:296 , TYR C:297 , CLA C:1026 , CLA C:1031 , BCR C:1054	BINDING SITE FOR RESIDUE CLA C 1025
026	CC8	SOFTWARE	HIS C:91 , LEU C:279 , MET C:282 , GLY C:283 , ALA C:286 , TYR C:297 , HIS C:430 , LEU C:433 , ALA C:434 , PHE C:437 , CLA C:1025 , CLA C:1027 , CLA C:1028 , CLA C:1034	BINDING SITE FOR RESIDUE CLA C 1026
027	CC9	SOFTWARE	ILE C:60 , VAL C:61 , TRP C:63 , ALA C:64 , LEU C:88 , LEU C:95 , TRP C:97 , VAL C:117 , HIS C:118 , LEU C:125 , CLA C:1026 , CLA C:1036 , BCR Z:1053	BINDING SITE FOR RESIDUE CLA C 1027
028	DC1	SOFTWARE	TRP C:63 , MET C:67 , PHE C:70 , GLY C:85 , ILE C:87 , TRP C:425 , LEU C:426 , SER C:429 , LEU C:433 , CLA C:1026 , CLA C:1034 , DGD C:1056 , DGD C:1057 , PRO K:26 , VAL K:27	BINDING SITE FOR RESIDUE CLA C 1028
029	DC2	SOFTWARE	PHE A:33 , MET A:127 , GLY A:128 , TRP A:131 , PHE C:264 , TYR C:274 , GLY C:277 , HIS C:441 , LEU C:442 , ALA C:445 , ARG C:449 , CLA C:1030 , CLA C:1031 , BCR C:1054 , PHE I:19 , PHE I:23	BINDING SITE FOR RESIDUE CLA C 1029
030	DC3	SOFTWARE	LEU C:161 , LEU C:165 , ILE C:243 , CYS C:244 , ALA C:246 , GLY C:247 , TRP C:250 , HIS C:251 , PHE C:257 , TRP C:259 , PHE C:264 , MET C:281 , CLA C:1029 , CLA C:1031 , BCR C:1054	BINDING SITE FOR RESIDUE CLA C 1030
031	DC4	SOFTWARE	MET C:157 , THR C:158 , ILE C:160 , LEU C:161 , HIS C:164 , PHE C:264 , TRP C:266 , TYR C:271 , TYR C:274 , SER C:275 , CLA C:1025 , CLA C:1029 , CLA C:1030 , CLA C:1033	BINDING SITE FOR RESIDUE CLA C 1031
032	DC5	SOFTWARE	LHG A:1063 , TRP C:36 , ALA C:37 , ASN C:39 , LEU C:272 , PHE C:436 , PHE C:437 , VAL C:439 , GLY C:440 , TRP C:443 , HIS C:444 , ARG C:447 , CLA C:1034 , CLA C:1035	BINDING SITE FOR RESIDUE CLA C 1032
033	DC6	SOFTWARE	ASN C:39 , ALA C:40 , HIS C:53 , HIS C:56 , MET C:157 , ILE C:160 , GLY C:268 , GLU C:269 , TYR C:271 , LEU C:272 , SER C:275 , CLA C:1031 , CLA C:1035 , CLA C:1036	BINDING SITE FOR RESIDUE CLA C 1033
034	DC7	SOFTWARE	PHE A:285 , LHG A:1063 , HIS C:56 , LEU C:59 , ILE C:60 , PHE C:62 , TRP C:63 , CLA C:1026 , CLA C:1028 , CLA C:1032 , CLA C:1035 , DGD C:1057 , PRO K:29 , PHE K:32 , PHE K:33	BINDING SITE FOR RESIDUE CLA C 1034
035	DC8	SOFTWARE	GLU C:29 , GLY C:38 , ASN C:39 , ALA C:40 , ARG C:41 , LYS C:48 , ALA C:52 , VAL C:130 , CLA C:1032 , CLA C:1033 , CLA C:1034 , PHE K:32 , ALA K:36 , PHE K:37 , GLN K:40 , BCR K:1052 , LEU Y:46 , VAL Z:20 , VAL Z:23	BINDING SITE FOR RESIDUE CLA C 1035
036	DC9	SOFTWARE	HIS C:53 , VAL C:54 , ALA C:57 , PHE C:147 , ILE C:160 , PHE C:163 , HIS C:164 , VAL C:167 , GLY C:171 , CLA C:1027 , CLA C:1033 , CLA C:1037 , BCR Z:1053	BINDING SITE FOR RESIDUE CLA C 1036
037	EC1	SOFTWARE	VAL C:54 , VAL C:124 , GLY C:128 , TYR C:131 , HIS C:132 , PHE C:147 , CLA C:1036 , BCR Z:1053	BINDING SITE FOR RESIDUE CLA C 1037
038	EC2	SOFTWARE	LEU A:41 , THR A:45 , PHE A:48 , TYR A:126 , GLN A:130 , ALA A:146 , TYR A:147 , LEU A:174 , ARG A:279 , CLA A:1003 , LEU D:209 , ALA D:212 , ILE D:213 , TRP D:253 , PHE D:257 , CLA D:1005 , PQ9 D:1042 , MGE D:1062	BINDING SITE FOR RESIDUE PHO A 1038
039	EC3	SOFTWARE	PHE A:206 , ALA A:209 , LEU A:210 , MET A:214 , PHE A:255 , LEU A:258 , CLA A:1006 , PQ9 A:1043 , ALA D:41 , TRP D:48 , GLY D:118 , LEU D:122 , PHE D:125 , GLN D:129 , ASN D:142 , PHE D:146 , PHE D:153 , PHE D:173 , GLY D:174 , PRO D:275 , LEU D:279 , CLA D:1004	BINDING SITE FOR RESIDUE PHO A 1039
040	EC4	SOFTWARE	TYR E:19 , HIS E:23 , THR E:26 , ILE E:27 , LEU E:30 , ILE F:15 , PHE F:16 , ARG F:19 , TRP F:20 , HIS F:24 , ILE F:31 , UNK N:14	BINDING SITE FOR RESIDUE HEM E 1040
041	EC5	SOFTWARE	ALA V:62 , CYS V:63 , CYS V:66 , HIS V:67 , THR V:74 , LEU V:78 , ASP V:79 , LEU V:80 , THR V:84 , TYR V:101 , THR V:107 , TYR V:108 , HIS V:118	BINDING SITE FOR RESIDUE HEM V 1041
042	EC6	SOFTWARE	PHO A:1038 , MET D:198 , MET D:199 , ALA D:202 , GLY D:203 , LEU D:209 , HIS D:214 , THR D:217 , ALA D:249 , ASN D:250 , TRP D:253 , ALA D:260 , PHE D:261 , LEU D:267 , PHE D:270 , VAL D:274 , CLA D:1005 , MGE D:1062 , VAL L:26 , LEU L:27 , LEU L:29 , LEU L:30 , MGE L:1061	BINDING SITE FOR RESIDUE PQ9 D 1042
043	EC7	SOFTWARE	MET A:214 , HIS A:215 , LEU A:218 , ALA A:251 , PHE A:255 , ILE A:259 , SER A:264 , PHE A:265 , LEU A:271 , CLA A:1006 , PHO A:1039 , LEU D:45 , CLA D:1004 , MGE J:1059	BINDING SITE FOR RESIDUE PQ9 A 1043
044	EC8	SOFTWARE	ILE A:38 , LEU A:42 , ALA A:43 , ILE A:46 , CYS A:47 , ILE A:50 , TRP A:105 , LEU A:106 , CLA A:1007 , PHE I:15	BINDING SITE FOR RESIDUE BCR A 1044
045	EC9	SOFTWARE	MET B:25 , LEU B:29 , CLA B:1015 , CLA B:1022 , BCR B:1047	BINDING SITE FOR RESIDUE BCR B 1045
046	FC1	SOFTWARE	SER B:36 , MET B:37 , LEU B:109 , BCR B:1047 , ALA t:5011 , CYS t:5012 , ILE t:5014 , PHE t:5018 , PHE t:5022	BINDING SITE FOR RESIDUE BCR T 1046
047	FC2	SOFTWARE	GLY B:32 , TRP B:33 , ILE B:101 , GLY B:105 , CLA B:1015 , BCR B:1045 , BCR t:1046	BINDING SITE FOR RESIDUE BCR B 1047
048	FC3	SOFTWARE	LEU B:106 , LEU B:107 , TRP B:113 , CLA B:1014 , CLA B:1023 , CLA B:1024 , PHE t:5022	BINDING SITE FOR RESIDUE BCR B 1048
049	FC4	SOFTWARE	CLA B:1009 , CLA B:1011 , PHE H:34 , MET H:35 , LEU H:37 , PHE H:38 , PHE H:41 , CLA H:1017	BINDING SITE FOR RESIDUE BCR H 1049
050	FC5	SOFTWARE	CLA A:1006 , TYR D:42 , LEU D:43 , GLY D:46 , GLY D:47 , LEU D:49 , THR D:50 , CLA D:1008 , PRO F:29 , THR F:30 , PHE F:33 , VAL J:21 , MGE J:1059	BINDING SITE FOR RESIDUE BCR D 1050
051	FC6	SOFTWARE	PHE C:62 , ALA J:14 , THR J:15 , LEU K:25 , ILE K:28 , PHE K:32 , ALA K:34 , LEU K:35 , PHE K:37 , VAL K:38 , BCR K:1052 , ILE Y:28 , GLY Y:29	BINDING SITE FOR RESIDUE BCR K 1051
052	FC7	SOFTWARE	ALA C:55 , LEU C:59 , VAL C:116 , LEU C:119 , SER C:122 , ALA C:123 , GLY C:126 , CLA C:1035 , LEU K:25 , PHE K:32 , BCR K:1051 , TRP Z:47	BINDING SITE FOR RESIDUE BCR K 1052
053	FC8	SOFTWARE	VAL C:116 , ILE C:120 , VAL C:124 , CLA C:1027 , CLA C:1036 , CLA C:1037 , VAL Z:51 , VAL Z:54 , GLY Z:55 , ASN Z:58	BINDING SITE FOR RESIDUE BCR Z 1053
054	FC9	SOFTWARE	ILE C:209 , LEU C:213 , ASP C:232 , GLY C:236 , HIS C:237 , ILE C:240 , PHE C:264 , CLA C:1025 , CLA C:1029 , CLA C:1030 , LEU I:24	BINDING SITE FOR RESIDUE BCR C 1054
055	GC1	SOFTWARE	LEU A:91 , PHE A:93 , LEU A:121 , ALA A:152 , PHE A:155 , LEU A:159 , ILE A:160 , ILE A:163 , PRO C:217 , PHE C:218 , GLY C:219 , GLU C:221 , PHE C:284 , CYS C:288 , PHE C:292 , ASN C:294 , ARG C:362 , LEU C:438	BINDING SITE FOR RESIDUE DGD C 1055
056	GC2	SOFTWARE	PHE A:197 , PHE A:285 , LEU A:297 , GLU C:83 , GLN C:84 , GLY C:85 , LEU C:404 , SER C:406 , ASN C:418 , VAL C:420 , TRP C:425 , THR C:428 , SER C:429 , CLA C:1028 , DGD C:1057 , PHE J:29 , TYR J:33 , VAL K:30	BINDING SITE FOR RESIDUE DGD C 1056
057	GC3	SOFTWARE	PRO A:196 , GLN A:199 , TRP A:278 , PHE A:300 , SER A:305 , CLA A:1006 , LEU C:404 , ASN C:405 , SER C:406 , ASN C:415 , SER C:416 , ASN C:418 , CLA C:1028 , CLA C:1034 , DGD C:1056 , PHE J:29 , ALA J:32 , TYR J:33 , GLY J:37 , SER J:38 , SER J:39 , MGE J:1059 , GLN V:60	BINDING SITE FOR RESIDUE DGD C 1057
058	GC4	SOFTWARE	TYR B:193 , PHE B:250 , VAL B:251 , ALA B:253 , TYR B:258 , TYR B:273 , ALA B:456 , LEU B:460 , PHE B:463 , CLA B:1010 , GLY D:86 , HIS D:87 , ILE D:123 , VAL D:154 , ILE D:159 , LEU D:162 , LEU D:291 , TYR H:49 , ASN H:50 , VAL H:60 , SER H:61 , TRP H:62	BINDING SITE FOR RESIDUE DGD H 1058
059	GC5	SOFTWARE	PQ9 A:1043 , DGD C:1057 , LEU D:49 , TYR D:67 , GLY D:70 , CYS D:71 , PHE D:73 , CLA D:1004 , BCR D:1050 , LEU F:26 , MET F:40 , GLN F:41 , PHE J:28 , GLY J:31 , ALA J:32 , GLY J:35 , LEU J:36 , GLY J:37	BINDING SITE FOR RESIDUE MGE J 1059
060	GC6	SOFTWARE	TRP B:5 , ARG B:7 , PHE B:464 , TRP B:468 , CLA B:1015 , CLA B:1019 , CLA B:1021 , TYR D:141 , SER D:147 , PHE D:269 , PHE D:273 , MGE L:1061	BINDING SITE FOR RESIDUE MGE B 1060
061	GC7	SOFTWARE	SER A:232 , ASN A:234 , TRP B:5 , TYR B:6 , CLA B:1019 , CLA B:1022 , MGE B:1060 , TRP D:266 , PHE D:269 , PHE D:270 , PHE D:273 , PQ9 D:1042 , MGE D:1062 , ASN L:13 , SER L:16 , GLY L:20 , LEU L:22 , LEU L:23 , VAL L:26 , PRO M:18 , PHE M:21 , LEU M:22	BINDING SITE FOR RESIDUE MGE L 1061
062	GC8	SOFTWARE	CLA A:1003 , PHO A:1038 , ILE D:256 , PHE D:257 , PHE D:261 , SER D:262 , TRP D:266 , CLA D:1005 , PQ9 D:1042 , ASN L:13 , THR L:15 , TYR L:18 , LEU L:19 , MGE L:1061 , ILE T:13 , PHE T:17 , ALA T:20	BINDING SITE FOR RESIDUE MGE D 1062
063	GC9	SOFTWARE	ARG A:140 , TRP A:142 , TYR A:262 , SER A:264 , PHE A:265 , ASN A:266 , SER A:270 , PHE A:273 , VAL A:281 , TRP C:36 , PHE C:436 , TRP C:443 , ARG C:447 , CLA C:1032 , CLA C:1034 , GLU D:219 , ALA D:229 , SER D:230	BINDING SITE FOR RESIDUE LHG A 1063
064	HC1	SOFTWARE	ASN A:181 , GLU A:333 , LYS D:317	BINDING SITE FOR RESIDUE BR A 1064
065	HC2	SOFTWARE	HIS A:337 , ASN A:338 , PHE A:339 , GLU C:354	BINDING SITE FOR RESIDUE BR A 1065
066	HC3	SOFTWARE	ASP a:5061 , ASP a:5170 , GLU a:5189 , HIS a:5332 , GLU a:5333 , ASP a:5342 , ALA a:5344 , GLU c:5354 , ARG c:5357	BINDING SITE FOR RESIDUE OEC A 6001
067	HC4	SOFTWARE	HIS a:5215 , TYR a:5246 , HIS a:5272 , HIS d:5214 , TYR d:5244 , HIS d:5268	BINDING SITE FOR RESIDUE FE2 A 6002
068	HC5	SOFTWARE	PHE a:5119 , PRO a:5150 , SER a:5153 , ALA a:5154 , VAL a:5157 , PHE a:5182 , MET a:5183 , ILE a:5184 , GLN a:5187 , HIS a:5198 , GLY a:5201 , VAL a:5202 , PHE a:5206 , ARG a:5279 , ALA a:5286 , ALA a:5287 , ILE a:5290 , CLA a:6006 , LEU d:5182 , CLA d:6004 , CLA d:6005 , PHO d:6038 , MGE d:6062	BINDING SITE FOR RESIDUE CLA A 6003
069	HC6	SOFTWARE	MET a:5183 , PHE a:5206 , CLA a:6003 , CLA a:6006 , PHO a:6039 , PQ9 a:6043 , LEU d:5045 , LEU d:5122 , VAL d:5152 , VAL d:5156 , PHE d:5181 , LEU d:5182 , GLN d:5186 , TRP d:5191 , HIS d:5197 , GLY d:5200 , VAL d:5201 , VAL d:5204 , SER d:5282 , ALA d:5283 , VAL d:5286 , CLA d:6005 , MGE d:6059	BINDING SITE FOR RESIDUE CLA D 6004
070	HC7	SOFTWARE	THR a:5045 , PHE a:5119 , VAL a:5157 , PHE a:5158 , MET a:5172 , ILE a:5176 , THR a:5179 , PHE a:5182 , MET a:5183 , CLA a:6003 , MET d:5198 , VAL d:5201 , ALA d:5202 , LEU d:5205 , GLY d:5206 , CLA d:6004 , PHO d:6038 , PQ9 d:6042 , MGE d:6062	BINDING SITE FOR RESIDUE CLA D 6005
071	HC8	SOFTWARE	VAL a:5202 , ALA a:5203 , PHE a:5206 , LEU a:5210 , CLA a:6003 , PHO a:6039 , PQ9 a:6043 , DGD c:6057 , PHE d:5157 , VAL d:5175 , ILE d:5178 , PHE d:5179 , LEU d:5182 , CLA d:6004 , BCR d:6050	BINDING SITE FOR RESIDUE CLA A 6006
072	HC9	SOFTWARE	THR a:5040 , PHE a:5093 , TYR a:5094 , PRO a:5095 , ILE a:5096 , TRP a:5097 , LEU a:5114 , HIS a:5118 , BCR a:6044 , TYR i:5009 , VAL i:5011 , THR i:5013 , PHE i:5015	BINDING SITE FOR RESIDUE CLA A 6007
073	IC1	SOFTWARE	CLA b:6016 , LEU d:5036 , PRO d:5039 , CYS d:5040 , LEU d:5089 , LEU d:5090 , LEU d:5091 , LEU d:5092 , TRP d:5093 , TRP d:5104 , PHE d:5113 , LEU d:5116 , HIS d:5117 , PHE d:5120 , BCR d:6050 , MET h:5035 , LEU x:5023 , GLY x:5026 , ALA x:5027 , LEU x:5030	BINDING SITE FOR RESIDUE CLA D 6008
074	IC2	SOFTWARE	PHE b:5187 , CLA b:6010 , LEU h:5037 , BCR h:6049	BINDING SITE FOR RESIDUE CLA B 6009
075	IC3	SOFTWARE	GLY b:5186 , PHE b:5187 , GLY b:5194 , HIS b:5198 , ALA b:5202 , PHE b:5244 , PHE b:5247 , VAL b:5248 , CLA b:6009 , CLA b:6011 , CLA b:6017 , VAL d:5154 , ILE d:5159 , ILE h:5045 , LEU h:5046 , TYR h:5049 , DGD h:6058	BINDING SITE FOR RESIDUE CLA B 6010
076	IC4	SOFTWARE	ARG b:5065 , LEU b:5066 , ALA b:5143 , LEU b:5146 , CYS b:5147 , VAL b:5195 , HIS b:5198 , HIS b:5199 , ALA b:5245 , CLA b:6010 , CLA b:6013 , CLA b:6014 , CLA b:6016 , CLA b:6017 , CLA b:6018 , PHE h:5038 , LEU h:5039 , BCR h:6049	BINDING SITE FOR RESIDUE CLA B 6011
077	IC5	SOFTWARE	TRP b:5030 , PHE b:5062 , ARG b:5065 , LEU b:5145 , LEU b:5146 , ALA b:5246 , VAL b:5249 , PHE b:5448 , PHE b:5455 , PHE b:5459 , CLA b:6013 , CLA b:6015 , CLA b:6018 , CLA b:6023 , CLA b:6024	BINDING SITE FOR RESIDUE CLA B 6012
078	IC6	SOFTWARE	THR b:5024 , VAL b:5027 , ALA b:5028 , TRP b:5030 , ALA b:5031 , VAL b:5059 , MET b:5063 , LEU b:5066 , VAL b:5093 , HIS b:5097 , ALA b:5202 , CLA b:6011 , CLA b:6012 , CLA b:6014 , CLA b:6018 , CLA b:6020 , CLA b:6023	BINDING SITE FOR RESIDUE CLA B 6013
079	IC7	SOFTWARE	TRP b:5088 , ALA b:5096 , VAL b:5099 , LEU b:5100 , LEU b:5146 , GLY b:5149 , PHE b:5150 , PHE b:5153 , HIS b:5154 , PHE b:5159 , GLY b:5160 , CLA b:6011 , CLA b:6013 , BCR b:6048	BINDING SITE FOR RESIDUE CLA B 6014
080	IC8	SOFTWARE	BCR T:6046 , TRP b:5030 , MET b:5034 , TYR b:5037 , GLY b:5056 , PHE b:5058 , PRO b:5326 , TRP b:5447 , PHE b:5448 , ALA b:5451 , CLA b:6012 , BCR b:6045 , BCR b:6047 , MGE b:6060 , LEU l:5027 , PHE l:5031	BINDING SITE FOR RESIDUE CLA B 6015
081	IC9	SOFTWARE	THR b:5233 , SER b:5237 , ALA b:5240 , PHE b:5460 , HIS b:5463 , ILE b:5464 , GLY b:5467 , THR b:5470 , CLA b:6011 , CLA b:6017 , CLA b:6018 , PHE d:5120 , MET d:5126 , LEU d:5127 , PHE d:5130 , CLA d:6008 , LEU h:5043 , LEU h:5046	BINDING SITE FOR RESIDUE CLA B 6016
082	JC1	SOFTWARE	PHE b:5136 , ALA b:5209 , PHE b:5212 , HIS b:5213 , PRO b:5218 , PRO b:5219 , LEU b:5222 , CLA b:6010 , CLA b:6011 , CLA b:6016 , CLA b:6018 , THR h:5027 , LEU h:5030 , MET h:5031 , PHE h:5034 , MET h:5035 , LEU h:5039 , BCR h:6049	BINDING SITE FOR RESIDUE CLA B 6017
083	JC2	SOFTWARE	HIS b:5020 , LEU b:5132 , PRO b:5133 , PHE b:5136 , HIS b:5139 , LEU b:5226 , MET b:5228 , ILE b:5231 , VAL b:5234 , SER b:5237 , SER b:5238 , CLA b:6011 , CLA b:6012 , CLA b:6013 , CLA b:6016 , CLA b:6017 , CLA b:6020 , CLA b:6023	BINDING SITE FOR RESIDUE CLA B 6018
084	JC3	SOFTWARE	TRP b:5002 , TYR b:5003 , ARG b:5004 , HIS b:5006 , LEU b:5458 , PHE b:5459 , PHE b:5461 , GLY b:5462 , TRP b:5465 , HIS b:5466 , CLA b:6020 , CLA b:6021 , MGE b:6060 , MGE d:6061 , PHE m:5021	BINDING SITE FOR RESIDUE CLA B 6019
085	JC4	SOFTWARE	HIS b:5006 , LEU b:5016 , HIS b:5020 , HIS b:5023 , THR b:5024 , VAL b:5027 , VAL b:5234 , LEU b:5235 , SER b:5238 , CLA b:6013 , CLA b:6018 , CLA b:6019 , CLA b:6021 , CLA b:6022 , CLA b:6023	BINDING SITE FOR RESIDUE CLA B 6020
086	JC5	SOFTWARE	HIS b:5006 , HIS b:5023 , TRP b:5030 , LEU b:5458 , PHE b:5459 , CLA b:6019 , CLA b:6020 , CLA b:6022 , MGE b:6060 , PRO m:5018	BINDING SITE FOR RESIDUE CLA B 6021
087	JC6	SOFTWARE	SER M:36 , VAL b:5005 , HIS b:5006 , ALA b:5019 , HIS b:5023 , LEU b:5026 , CLA b:6020 , CLA b:6021 , BCR b:6045 , MGE d:6061 , ARG l:5007 , VAL l:5010 , PHE m:5021 , LEU m:5025	BINDING SITE FOR RESIDUE CLA B 6022
088	JC7	SOFTWARE	ILE b:5017 , HIS b:5020 , LEU b:5130 , MET b:5135 , ILE b:5138 , HIS b:5139 , LEU b:5142 , CLA b:6012 , CLA b:6013 , CLA b:6018 , CLA b:6020 , CLA b:6024 , BCR b:6048 , LEU h:5007	BINDING SITE FOR RESIDUE CLA B 6023
089	JC8	SOFTWARE	ALA b:5107 , TRP b:5110 , HIS b:5111 , LEU b:5119 , CLA b:6012 , CLA b:6023 , BCR b:6048 , THR h:5005 , LEU h:5007 , GLY h:5008	BINDING SITE FOR RESIDUE CLA B 6024
090	JC9	SOFTWARE	THR c:5094 , ALA c:5172 , LEU c:5175 , HIS c:5237 , ALA c:5278 , MET c:5282 , ILE c:5285 , PHE c:5289 , TYR c:5297 , CLA c:6026 , CLA c:6031 , BCR c:6054	BINDING SITE FOR RESIDUE CLA C 6025
091	KC1	SOFTWARE	HIS c:5091 , LEU c:5279 , MET c:5282 , GLY c:5283 , ALA c:5286 , TYR c:5297 , HIS c:5430 , LEU c:5433 , PHE c:5437 , CLA c:6025 , CLA c:6027 , CLA c:6028 , CLA c:6034	BINDING SITE FOR RESIDUE CLA C 6026
092	KC2	SOFTWARE	ILE c:5060 , VAL c:5061 , TRP c:5063 , ALA c:5064 , LEU c:5088 , HIS c:5091 , LEU c:5095 , TRP c:5097 , VAL c:5117 , HIS c:5118 , CLA c:6026 , CLA c:6036 , BCR z:6053	BINDING SITE FOR RESIDUE CLA C 6027
093	KC3	SOFTWARE	TRP c:5063 , MET c:5067 , PHE c:5070 , GLY c:5085 , ILE c:5087 , TRP c:5425 , LEU c:5426 , SER c:5429 , LEU c:5433 , CLA c:6026 , CLA c:6034 , DGD c:6056 , DGD c:6057 , VAL k:5027 , VAL k:5030	BINDING SITE FOR RESIDUE CLA C 6028
094	KC4	SOFTWARE	PHE a:5033 , MET a:5127 , GLY a:5128 , TRP a:5131 , TYR c:5274 , HIS c:5441 , LEU c:5442 , ALA c:5445 , ARG c:5449 , CLA c:6030 , CLA c:6031 , BCR c:6054 , PHE i:5019 , PHE i:5023	BINDING SITE FOR RESIDUE CLA C 6029
095	KC5	SOFTWARE	LEU c:5161 , LEU c:5165 , ILE c:5243 , CYS c:5244 , ALA c:5246 , GLY c:5247 , TRP c:5250 , HIS c:5251 , PHE c:5257 , TRP c:5259 , PHE c:5264 , MET c:5281 , CLA c:6029 , CLA c:6031 , BCR c:6054	BINDING SITE FOR RESIDUE CLA C 6030
096	KC6	SOFTWARE	MET c:5157 , THR c:5158 , ILE c:5160 , LEU c:5161 , HIS c:5164 , PHE c:5264 , TYR c:5271 , TYR c:5274 , SER c:5275 , CLA c:6025 , CLA c:6029 , CLA c:6030 , CLA c:6033	BINDING SITE FOR RESIDUE CLA C 6031
097	KC7	SOFTWARE	LHG a:6063 , TRP c:5036 , ALA c:5037 , ASN c:5039 , LEU c:5272 , PHE c:5436 , PHE c:5437 , VAL c:5439 , GLY c:5440 , TRP c:5443 , HIS c:5444 , ARG c:5447 , CLA c:6034 , CLA c:6035	BINDING SITE FOR RESIDUE CLA C 6032
098	KC8	SOFTWARE	ASN c:5039 , ALA c:5040 , HIS c:5053 , HIS c:5056 , TRP c:5151 , MET c:5157 , ILE c:5160 , GLY c:5268 , TYR c:5271 , LEU c:5272 , SER c:5275 , CLA c:6031 , CLA c:6035 , CLA c:6036	BINDING SITE FOR RESIDUE CLA C 6033
099	KC9	SOFTWARE	PHE a:5285 , LHG a:6063 , HIS c:5056 , LEU c:5059 , ILE c:5060 , TRP c:5063 , CLA c:6026 , CLA c:6028 , CLA c:6032 , CLA c:6035 , DGD c:6057 , PRO k:5029	BINDING SITE FOR RESIDUE CLA C 6034
100	LC1	SOFTWARE	GLU c:5029 , GLY c:5038 , ASN c:5039 , ALA c:5040 , ARG c:5041 , LYS c:5048 , ALA c:5052 , VAL c:5130 , CLA c:6032 , CLA c:6033 , CLA c:6034 , PHE k:5032 , LEU k:5035 , PHE k:5037 , GLN k:5040 , BCR k:6052 , LEU y:5028 , VAL z:5020 , VAL z:5023	BINDING SITE FOR RESIDUE CLA C 6035
101	LC2	SOFTWARE	LEU c:5050 , HIS c:5053 , VAL c:5054 , ALA c:5057 , PHE c:5147 , ILE c:5160 , PHE c:5163 , HIS c:5164 , VAL c:5167 , LEU c:5168 , ILE c:5170 , GLY c:5171 , CLA c:6027 , CLA c:6033 , CLA c:6037 , BCR z:6053	BINDING SITE FOR RESIDUE CLA C 6036
102	LC3	SOFTWARE	VAL c:5054 , VAL c:5124 , GLY c:5128 , TYR c:5131 , HIS c:5132 , PHE c:5147 , CLA c:6036 , BCR z:6053	BINDING SITE FOR RESIDUE CLA C 6037
103	LC4	SOFTWARE	LEU a:5041 , ALA a:5044 , THR a:5045 , PHE a:5048 , TYR a:5126 , GLN a:5130 , TYR a:5147 , LEU a:5174 , ARG a:5279 , CLA a:6003 , LEU d:5205 , ALA d:5208 , LEU d:5209 , ALA d:5212 , ILE d:5213 , TRP d:5253 , PHE d:5257 , CLA d:6005 , PQ9 d:6042 , MGE d:6062	BINDING SITE FOR RESIDUE PHO D 6038
104	LC5	SOFTWARE	PHE a:5206 , ALA a:5209 , LEU a:5210 , MET a:5214 , PHE a:5255 , LEU a:5258 , CLA a:6006 , LEU d:5037 , ALA d:5041 , TRP d:5048 , GLY d:5118 , LEU d:5122 , PHE d:5125 , GLN d:5129 , ASN d:5142 , PHE d:5146 , PRO d:5149 , PHE d:5153 , PHE d:5173 , GLY d:5174 , PRO d:5275 , LEU d:5279 , CLA d:6004	BINDING SITE FOR RESIDUE PHO A 6039
105	LC6	SOFTWARE	TYR e:5019 , HIS e:5023 , THR e:5026 , ILE e:5027 , LEU e:5030 , ILE f:5015 , PHE f:5016 , ARG f:5019 , TRP f:5020 , HIS f:5024 , ILE f:5031 , UNK n:5014 , UNK n:5018	BINDING SITE FOR RESIDUE HEM E 6040
106	LC7	SOFTWARE	ALA v:5062 , CYS v:5063 , CYS v:5066 , HIS v:5067 , THR v:5074 , LEU v:5078 , ASP v:5079 , THR v:5084 , LEU v:5085 , TYR v:5101 , THR v:5107 , TYR v:5108 , HIS v:5118	BINDING SITE FOR RESIDUE HEM V 6041
107	LC8	SOFTWARE	MET d:5198 , MET d:5199 , ALA d:5202 , LEU d:5209 , HIS d:5214 , THR d:5217 , ALA d:5249 , ASN d:5250 , TRP d:5253 , ALA d:5260 , PHE d:5261 , LEU d:5267 , PHE d:5270 , VAL d:5274 , CLA d:6005 , PHO d:6038 , MGE d:6061 , MGE d:6062 , VAL l:5026 , LEU l:5027 , LEU l:5029 , LEU l:5030	BINDING SITE FOR RESIDUE PQ9 D 6042
108	LC9	SOFTWARE	MET a:5214 , HIS a:5215 , LEU a:5218 , ALA a:5251 , HIS a:5252 , PHE a:5255 , ILE a:5259 , SER a:5264 , PHE a:5265 , LEU a:5271 , CLA a:6006 , LEU d:5045 , CLA d:6004 , MGE d:6059	BINDING SITE FOR RESIDUE PQ9 A 6043
109	MC1	SOFTWARE	VAL a:5035 , ILE a:5038 , LEU a:5042 , ALA a:5043 , ILE a:5046 , CYS a:5047 , ILE a:5050 , TRP a:5105 , LEU a:5106 , CLA a:6007 , PHE i:5015	BINDING SITE FOR RESIDUE BCR A 6044
110	MC2	SOFTWARE	BCR T:6046 , MET b:5022 , LEU b:5026 , CLA b:6015 , CLA b:6022 , BCR b:6047	BINDING SITE FOR RESIDUE BCR B 6045
111	MC3	SOFTWARE	ILE T:4 , PHE T:8 , ALA T:11 , ILE T:14 , PHE T:18 , PHE T:22 , SER b:5033 , MET b:5034 , CLA b:6015 , BCR b:6045 , BCR b:6047	BINDING SITE FOR RESIDUE BCR T 6046
112	MC4	SOFTWARE	BCR T:6046 , LEU b:5026 , GLY b:5029 , TRP b:5030 , ILE b:5098 , SER b:5101 , GLY b:5102 , CLA b:6015 , BCR b:6045	BINDING SITE FOR RESIDUE BCR B 6047
113	MC5	SOFTWARE	PHE T:22 , LEU b:5103 , LEU b:5104 , ALA b:5107 , CYS b:5109 , TRP b:5110 , CLA b:6014 , CLA b:6023 , CLA b:6024	BINDING SITE FOR RESIDUE BCR B 6048
114	MC6	SOFTWARE	CLA b:6009 , CLA b:6011 , CLA b:6017 , PHE h:5034 , MET h:5035 , LEU h:5037 , PHE h:5038 , PHE h:5041 , THR x:5011 , PHE x:5020	BINDING SITE FOR RESIDUE BCR H 6049
115	MC7	SOFTWARE	CLA a:6006 , TYR d:5042 , LEU d:5043 , GLY d:5046 , LEU d:5049 , THR d:5050 , CLA d:6008 , MGE d:6059 , LEU f:5026 , PRO f:5029 , THR f:5030 , PHE f:5033 , VAL j:5021	BINDING SITE FOR RESIDUE BCR D 6050
116	MC8	SOFTWARE	PHE c:5062 , THR j:5015 , MET j:5019 , LEU k:5025 , ILE k:5028 , LEU k:5031 , PHE k:5032 , ALA k:5034 , LEU k:5035 , PHE k:5037 , VAL k:5038 , BCR k:6052 , ILE y:5010 , GLY y:5011	BINDING SITE FOR RESIDUE BCR K 6051
117	MC9	SOFTWARE	ALA c:5055 , LEU c:5059 , VAL c:5116 , LEU c:5119 , ILE c:5120 , SER c:5122 , ALA c:5123 , GLY c:5126 , CLA c:6035 , PHE k:5032 , LEU k:5035 , BCR k:6051 , TRP z:5047	BINDING SITE FOR RESIDUE BCR K 6052
118	NC1	SOFTWARE	VAL c:5116 , ILE c:5120 , CLA c:6027 , CLA c:6036 , CLA c:6037 , VAL z:5051 , VAL z:5054 , GLY z:5055 , ASN z:5058	BINDING SITE FOR RESIDUE BCR Z 6053
119	NC2	SOFTWARE	ILE c:5209 , LEU c:5213 , ASP c:5232 , GLY c:5236 , HIS c:5237 , ILE c:5240 , PHE c:5264 , CLA c:6025 , CLA c:6029 , CLA c:6030 , LEU i:5024	BINDING SITE FOR RESIDUE BCR C 6054
120	NC3	SOFTWARE	LEU a:5091 , PHE a:5093 , LEU a:5121 , ALA a:5152 , PHE a:5155 , LEU a:5159 , ILE a:5160 , ILE a:5163 , PRO c:5217 , PHE c:5218 , GLY c:5219 , GLU c:5221 , VAL c:5227 , PHE c:5284 , CYS c:5288 , PHE c:5292 , ASN c:5294 , ARG c:5362 , LEU c:5438	BINDING SITE FOR RESIDUE DGD C 6055
121	NC4	SOFTWARE	PHE a:5197 , LEU a:5297 , GLU c:5083 , GLN c:5084 , GLY c:5085 , SER c:5406 , ASN c:5418 , VAL c:5420 , TRP c:5425 , THR c:5428 , SER c:5429 , CLA c:6028 , DGD c:6057 , PHE j:5029 , TYR j:5033	BINDING SITE FOR RESIDUE DGD C 6056
122	NC5	SOFTWARE	PRO a:5196 , GLN a:5199 , TRP a:5278 , PHE a:5300 , ASN a:5301 , SER a:5305 , CLA a:6006 , ASN c:5405 , SER c:5406 , VAL c:5407 , ASN c:5415 , SER c:5416 , VAL c:5417 , ASN c:5418 , CLA c:6028 , CLA c:6034 , DGD c:6056 , MGE d:6059 , PHE j:5029 , ALA j:5032 , TYR j:5033 , GLY j:5037 , SER j:5039 , GLN v:5060	BINDING SITE FOR RESIDUE DGD C 6057
123	NC6	SOFTWARE	PHE b:5247 , VAL b:5248 , ALA b:5250 , GLY b:5251 , TYR b:5255 , TYR b:5270 , ALA b:5453 , LEU b:5457 , PHE b:5460 , CLA b:6010 , GLY d:5086 , HIS d:5087 , ILE d:5159 , LEU d:5162 , VAL d:5287 , LEU d:5291 , TYR h:5049 , ASN h:5050 , VAL h:5060 , SER h:5061 , TRP h:5062	BINDING SITE FOR RESIDUE DGD H 6058
124	NC7	SOFTWARE	PQ9 a:6043 , DGD c:6057 , LEU d:5049 , TYR d:5067 , GLY d:5070 , CYS d:5071 , ASN d:5072 , PHE d:5073 , CLA d:6004 , BCR d:6050 , LEU f:5026 , ILE f:5037 , MET f:5040 , GLN f:5041 , PHE j:5028 , GLY j:5031 , ALA j:5032 , LEU j:5036 , GLY j:5037	BINDING SITE FOR RESIDUE MGE D 6059
125	NC8	SOFTWARE	TRP b:5002 , ARG b:5004 , PHE b:5461 , TRP b:5465 , CLA b:6015 , CLA b:6019 , CLA b:6021 , TYR d:5141 , PHE d:5269 , TRP d:5280 , MGE d:6061	BINDING SITE FOR RESIDUE MGE B 6060
126	NC9	SOFTWARE	SER a:5232 , ASN a:5234 , TRP b:5002 , CLA b:6019 , CLA b:6022 , MGE b:6060 , TRP d:5266 , PHE d:5269 , PHE d:5270 , PHE d:5273 , PQ9 d:6042 , MGE d:6062 , ASN l:5013 , SER l:5016 , GLY l:5020 , LEU l:5022 , LEU l:5023 , VAL l:5026 , PRO m:5018 , PHE m:5021 , LEU m:5022	BINDING SITE FOR RESIDUE MGE D 6061
127	OC1	SOFTWARE	CLA a:6003 , ILE d:5256 , PHE d:5257 , ILE d:5259 , PHE d:5261 , SER d:5262 , TRP d:5266 , PHE d:5270 , CLA d:6005 , PHO d:6038 , PQ9 d:6042 , MGE d:6061 , ASN l:5013 , THR l:5015 , LEU l:5019 , VAL l:5026 , ILE t:5013 , PHE t:5017 , ALA t:5020	BINDING SITE FOR RESIDUE MGE D 6062
128	OC2	SOFTWARE	ARG a:5140 , TRP a:5142 , TYR a:5262 , SER a:5264 , PHE a:5265 , ASN a:5266 , VAL a:5281 , TRP c:5036 , PHE c:5436 , TRP c:5443 , ARG c:5447 , CLA c:6032 , CLA c:6034 , GLU d:5219 , ALA d:5229 , SER d:5230	BINDING SITE FOR RESIDUE LHG A 6063
129	OC3	SOFTWARE	GLU a:5333 , LYS d:5317	BINDING SITE FOR RESIDUE BR D 6064
130	OC4	SOFTWARE	HIS a:5337 , ASN a:5338 , PHE a:5339 , GLU c:5354	BINDING SITE FOR RESIDUE BR A 6065

SS Bonds (2, 2)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 10)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:335
 aligned with PSBA_THEVL | P51765 from UniProtKB/Swiss-Prot  Length:360

    Alignment length:335
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339     
          PSBA_THEVL     10 SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWRVVGVWFAALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA  344
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhh..................................................hhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhh.........hhhhhhhhhhh.hhhhhhh.hhhhh...hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh..ee.................hhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0b A   10 SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWRVVGVWFAALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA  344
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339

Chain B from PDB  Type:PROTEIN  Length:485
 aligned with PSBB_THEVL | D0VWR1 from UniProtKB/Swiss-Prot  Length:505

    Alignment length:485
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483     
          PSBB_THEVL      4 WYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPE  488
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhh.hhhhhhhhhhhhhhh..................hhhhhhhhh.....................hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.........hhhhhhhhhhhhhhhhhhhhhhh..........ee........ee.......hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhh..hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhheeeee...eeee.....................eee.hhh.eeee.................eeee........ee.hhhhhhhhhhh......eeee............hhhhhhhhhhhhhhhhhhhhhh.hhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0b B    5 WYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPE  489
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484

Chain C from PDB  Type:PROTEIN  Length:447
 aligned with PSBC_THEVL | D0VWR7 from UniProtKB/Swiss-Prot  Length:451

    Alignment length:447
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       
          PSBC_THEVL      5 DQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD  451
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3a0bC02 C:304-399 photosystem ii from thermosynechococcus elongatus                             -------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..................hhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhh...................hhhhhhhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhh................eee.....eee..hhhhhh......hhhhh..............hhhhhhhhhhhhhh...ee.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..................... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0b C   27 DQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD  473
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466

Chain D from PDB  Type:PROTEIN  Length:340
 aligned with PSBD_THEVL | D0VWR8 from UniProtKB/Swiss-Prot  Length:342

    Alignment length:340
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342
          PSBD_THEVL      3 GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL  342
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh.....................ee.....................hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.hhhhhhh........eehhhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh............................hhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0b D   13 GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL  352
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352

Chain E from PDB  Type:PROTEIN  Length:82
 aligned with PSBE_THEVL | P12238 from UniProtKB/Swiss-Prot  Length:84

    Alignment length:82
                                    12        22        32        42        52        62        72        82  
          PSBE_THEVL      3 GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK   84
               SCOP domains ---------------------------------------------------------------------------------- SCOP domains
               CATH domains 3a0bE00 E:3-84 Photosystem q(b) protein helix                                      CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh......................hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------CYTOCHROME_B559-------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                3a0b E    3 GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK   84
                                    12        22        32        42        52        62        72        82

Chain F from PDB  Type:PROTEIN  Length:35
 aligned with PSBF_THEVL | P12239 from UniProtKB/Swiss-Prot  Length:45

    Alignment length:35
                                    20        30        40     
          PSBF_THEVL     11 VSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR   45
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                PROSITE (2) ----CYTOCHROME_B559---------------- PROSITE (2)
                 Transcript ----------------------------------- Transcript
                3a0b F   11 VSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR   45
                                    20        30        40

Chain H from PDB  Type:PROTEIN  Length:64
 aligned with PSBH_THEVL | P19052 from UniProtKB/Swiss-Prot  Length:65

    Alignment length:64
                                    10        20        30        40        50        60    
          PSBH_THEVL      1 ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL   64
               SCOP domains ---------------------------------------------------------------- SCOP domains
               CATH domains 3a0bH01 H:2-52                                     ------------- CATH domains
               Pfam domains ---------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhh................hhhhhhhhhhhhhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------- Transcript
                3a0b H    2 ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL   65
                                    11        21        31        41        51        61

Chain I from PDB  Type:PROTEIN  Length:35
 aligned with PSBI_THEVL | P12240 from UniProtKB/Swiss-Prot  Length:38

    Alignment length:35
                                    10        20        30     
          PSBI_THEVL      1 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK   35
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------- PROSITE
                 Transcript ----------------------------------- Transcript
                3a0b I    1 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK   35
                                    10        20        30

Chain J from PDB  Type:PROTEIN  Length:34
 aligned with PSBJ_THEVL | Q7DGD4 from UniProtKB/Swiss-Prot  Length:40

    Alignment length:34
                                    16        26        36    
          PSBJ_THEVL      7 RIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL   40
               SCOP domains ---------------------------------- SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains ---------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------- PROSITE
                 Transcript ---------------------------------- Transcript
                3a0b J    7 RIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL   40
                                    16        26        36

Chain K from PDB  Type:PROTEIN  Length:36
 aligned with PSBK_THEVL | P19054 from UniProtKB/Swiss-Prot  Length:37

    Alignment length:36
                                    10        20        30      
          PSBK_THEVL      1 KLPEAYAIFDPLVDVLPVIPVLFFALAFVVQAAVGF   36
               SCOP domains ------------------------------------ SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
                 Transcript ------------------------------------ Transcript
                3a0b K   10 KLPEAYAIFDPLVDVLPVIPVLFFALAFVVQAAVGF   45
                                    19        29        39

Chain L from PDB  Type:PROTEIN  Length:37
 aligned with PSBL_THEVL | P12241 from UniProtKB/Swiss-Prot  Length:37

    Alignment length:37
                                    10        20        30       
          PSBL_THEVL      1 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN   37
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author ...............hhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                3a0b L    1 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN   37
                                    10        20        30

Chain M from PDB  Type:PROTEIN  Length:36
 aligned with PSBM_THEVL | P12312 from UniProtKB/Swiss-Prot  Length:36

    Alignment length:36
                                    10        20        30      
          PSBM_THEVL      1 MEVNQLGFIATALFVLVPSVFLIILYVQTESQQKSS   36
               SCOP domains ------------------------------------ SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
                 Transcript ------------------------------------ Transcript
                3a0b M    1 MEVNQLGFIATALFVLVPSVFLIILYVQTESQQKSS   36
                                    10        20        30

Chain N from PDB  Type:PROTEIN  Length:24
                                                         
               SCOP domains ------------------------ SCOP domains
               CATH domains ------------------------ CATH domains
               Pfam domains ------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------ SAPs(SNPs)
                    PROSITE ------------------------ PROSITE
                 Transcript ------------------------ Transcript
                3a0b N    1 xxxxxxxxxxxxxxxxxxxxxxxx   24
                            ||||||||10||||||||20||||
                            1-UNK|||10-UNK|||19-UNK|
                             2-UNK|||11-UNK|||20-UNK
                              3-UNK|| 12-UNK|| 21-UNK
                               4-UNK|  13-UNK|  22-UNK
                                5-UNK   14-UNK   23-UNK
                                 6-UNK   15-UNK   24-UNK
                                  7-UNK   16-UNK    
                                   8-UNK   17-UNK   
                                    9-UNK   18-UNK

Chain O from PDB  Type:PROTEIN  Length:242
 aligned with PSBO_THEVL | D0VWR2 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:242
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241  
          PSBO_THEVL      2 TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP  243
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------3a0bO01 O:50-178,O:215-271 Photosystem II, cytochrome c-550 precursor                                                            3a0bO02 O:179-214                   3a0bO01 O:50-178,O:215-271                                CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..................ee.......eeeeeeeeeeeeeee...........eee.ee.......ee.....eee.....eee.........eeeee.....eeeee.......ee......ee........eeee.................................hhhhhh.....eeeeeeeeeeee......eeeeeeeeee...........eeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0b O   30 TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP  271
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269

Chain T from PDB  Type:PROTEIN  Length:30
 aligned with PSBT_THEVL | P12313 from UniProtKB/Swiss-Prot  Length:32

    Alignment length:30
                                    10        20        30
          PSBT_THEVL      1 METITYVFIFACIIALFFFAIFFREPPRIT   30
               SCOP domains ------------------------------ SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains ------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                3a0b T    1 METITYVFIFACIIALFFFAIFFREPPRIT   30
                                    10        20        30

Chain U from PDB  Type:PROTEIN  Length:98
 aligned with PSBU_THEVL | P56152 from UniProtKB/Swiss-Prot  Length:104

    Alignment length:98
                                    16        26        36        46        56        66        76        86        96        
          PSBU_THEVL      7 EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK  104
               SCOP domains -------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3a0bU01 U:37-123 Photosystem II 12 kDa extrinsic protein                               ----------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhh.....ee....hhhhh........hhhhhhhhh....hhhhhhh....hhhhhhhhhhhhh.ee....hhhhhh........... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                3a0b U   37 EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK  134
                                    46        56        66        76        86        96       106       116       126

Chain V from PDB  Type:PROTEIN  Length:137
 aligned with CY550_THEVL | P0A387 from UniProtKB/Swiss-Prot  Length:163

    Alignment length:137
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       
         CY550_THEVL     27 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY  163
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3a0bV00 V:27-163 Cytochrome c                                                                                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eee......eee.hhhhhhhhhhhhhhhh...hhhhh.........hhhhhhhh.....hhhhhhhhhhh.......................hhhhhhhhhhhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------CYTC  PDB: V:50-149 UniProt: 50-149                                                                 -------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0b V   27 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY  163
                                    36        46        56        66        76        86        96       106       116       126       136       146       156

Chain X from PDB  Type:PROTEIN  Length:34
 aligned with PSBX_THEVL | D0VWR4 from UniProtKB/Swiss-Prot  Length:40

    Alignment length:34
                                    10        20        30    
          PSBX_THEVL      1 TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQID   34
               SCOP domains ---------------------------------- SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains ---------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------- PROSITE
                 Transcript ---------------------------------- Transcript
                3a0b X   11 TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQID   44
                                    20        30        40

Chain Y from PDB  Type:PROTEIN  Length:28
 aligned with YCF12_THEVL | D0VWR3 from UniProtKB/Swiss-Prot  Length:30

    Alignment length:28
                                    12        22        
         YCF12_THEVL      3 IAQLTMIAMIGIAGPMIIFLLAVRRGNL   30
               SCOP domains ---------------------------- SCOP domains
               CATH domains ---------------------------- CATH domains
               Pfam domains ---------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh.hhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------- SAPs(SNPs)
                    PROSITE ---------------------------- PROSITE
                 Transcript ---------------------------- Transcript
                3a0b Y   19 IAQLTMIAMIGIAGPMIIFLLAVRRGNL   46
                                    28        38

Chain Z from PDB  Type:PROTEIN  Length:62
 aligned with PSBZ_THEVL | D0VWR5 from UniProtKB/Swiss-Prot  Length:62

    Alignment length:62
                                    10        20        30        40        50        60  
          PSBZ_THEVL      1 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV   62
               SCOP domains -------------------------------------------------------------- SCOP domains
               CATH domains 3a0bZ00 Z:1-62 Helix hairpin bin                               CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                3a0b Z    1 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV   62
                                    10        20        30        40        50        60

Chain a from PDB  Type:PROTEIN  Length:335
 aligned with PSBA_THEVL | P51765 from UniProtKB/Swiss-Prot  Length:360

    Alignment length:335
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339     
          PSBA_THEVL     10 SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWRVVGVWFAALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA  344
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhh............................ee..................hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhh.........hhhhhhhhhhh.hhhhhhh.hhhhh..eehhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh..........................hhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhh...ee.................hhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0b a 5010 SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWRVVGVWFAALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA 5344
                                  5019      5029      5039      5049      5059      5069      5079      5089      5099      5109      5119      5129      5139      5149      5159      5169      5179      5189      5199      5209      5219      5229      5239      5249      5259      5269      5279      5289      5299      5309      5319      5329      5339

Chain b from PDB  Type:PROTEIN  Length:485
 aligned with PSBB_THEVL | D0VWR1 from UniProtKB/Swiss-Prot  Length:505

    Alignment length:485
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483     
          PSBB_THEVL      4 WYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPE  488
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhhhhhhhhhhhhhhh..................hhhhhhhhh.....................hhhhhhhhhhhhhhhhhhhhhhhhhh..hhh.ee....ee..hhhhhhhhhhhhhhhhhhhhhhh..........ee........ee.......hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhh......hhhhhhhhhhhhhhhhhhhhhhh.......hhhhhh.hhhhh..hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh....hhhhh......hhhhhh.eeeee..eeeee.......eee...........eee.hhh.eeee.................eeeee.......ee.hhhhhhhhhhhhh....eeee............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0b b 5002 WYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPE 5486
                                  5011      5021      5031      5041      5051      5061      5071      5081      5091      5101      5111      5121      5131      5141      5151      5161      5171      5181      5191      5201      5211      5221      5231      5241      5251      5261      5271      5281      5291      5301      5311      5321      5331      5341      5351      5361      5371      5381      5391      5401      5411      5421      5431      5441      5451      5461      5471      5481

Chain c from PDB  Type:PROTEIN  Length:447
 aligned with PSBC_THEVL | D0VWR7 from UniProtKB/Swiss-Prot  Length:451

    Alignment length:447
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       
          PSBC_THEVL      5 DQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD  451
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3a0bc02 c:5304-5399 photosystem ii from thermosynechococcus elongatus                           -------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhh..................hhhhhhhhhhhhhhhhhhhhhhhhhhh......ee.......ee........hhhhhhhh................hhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhh................eee.....eee..hhhhhh......hhhhh...............hhhhhhhhhhhhh...ee.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...................... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0b c 5027 DQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD 5473
                                  5036      5046      5056      5066      5076      5086      5096      5106      5116      5126      5136      5146      5156      5166      5176      5186      5196      5206      5216      5226      5236      5246      5256      5266      5276      5286      5296      5306      5316      5326      5336      5346      5356      5366      5376      5386      5396      5406      5416      5426      5436      5446      5456      5466

Chain d from PDB  Type:PROTEIN  Length:340
 aligned with PSBD_THEVL | D0VWR8 from UniProtKB/Swiss-Prot  Length:342

    Alignment length:340
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342
          PSBD_THEVL      3 GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL  342
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhh.............................hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh............................hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0b d 5013 GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL 5352
                                  5022      5032      5042      5052      5062      5072      5082      5092      5102      5112      5122      5132      5142      5152      5162      5172      5182      5192      5202      5212      5222      5232      5242      5252      5262      5272      5282      5292      5302      5312      5322      5332      5342      5352

Chain e from PDB  Type:PROTEIN  Length:82
 aligned with PSBE_THEVL | P12238 from UniProtKB/Swiss-Prot  Length:84

    Alignment length:82
                                    12        22        32        42        52        62        72        82  
          PSBE_THEVL      3 GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK   84
               SCOP domains ---------------------------------------------------------------------------------- SCOP domains
               CATH domains 3a0be00 e:5003-5084 Photosystem q(b) protein helix                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............hhhhhh...hhhhhhhhhhhhhhhhhhhhhh......................hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------CYTOCHROME_B559-------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                3a0b e 5003 GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK 5084
                                  5012      5022      5032      5042      5052      5062      5072      5082

Chain f from PDB  Type:PROTEIN  Length:35
 aligned with PSBF_THEVL | P12239 from UniProtKB/Swiss-Prot  Length:45

    Alignment length:35
                                    20        30        40     
          PSBF_THEVL     11 VSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR   45
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                PROSITE (2) ----CYTOCHROME_B559---------------- PROSITE (2)
                 Transcript ----------------------------------- Transcript
                3a0b f 5011 VSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR 5045
                                  5020      5030      5040

Chain h from PDB  Type:PROTEIN  Length:64
 aligned with PSBH_THEVL | P19052 from UniProtKB/Swiss-Prot  Length:65

    Alignment length:64
                                    10        20        30        40        50        60    
          PSBH_THEVL      1 ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL   64
               SCOP domains ---------------------------------------------------------------- SCOP domains
               CATH domains 3a0bh01 h:5002-5052                                ------------- CATH domains
               Pfam domains ---------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhh................hhhhhhhhhhhhhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------- Transcript
                3a0b h 5002 ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL 5065
                                  5011      5021      5031      5041      5051      5061

Chain i from PDB  Type:PROTEIN  Length:35
 aligned with PSBI_THEVL | P12240 from UniProtKB/Swiss-Prot  Length:38

    Alignment length:35
                                    10        20        30     
          PSBI_THEVL      1 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK   35
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------- PROSITE
                 Transcript ----------------------------------- Transcript
                3a0b i 5001 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK 5035
                                  5010      5020      5030

Chain j from PDB  Type:PROTEIN  Length:34
 aligned with PSBJ_THEVL | Q7DGD4 from UniProtKB/Swiss-Prot  Length:40

    Alignment length:34
                                    16        26        36    
          PSBJ_THEVL      7 RIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL   40
               SCOP domains ---------------------------------- SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains ---------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh....hhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------- PROSITE
                 Transcript ---------------------------------- Transcript
                3a0b j 5007 RIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL 5040
                                  5016      5026      5036

Chain k from PDB  Type:PROTEIN  Length:36
 aligned with PSBK_THEVL | P19054 from UniProtKB/Swiss-Prot  Length:37

    Alignment length:36
                                    10        20        30      
          PSBK_THEVL      1 KLPEAYAIFDPLVDVLPVIPVLFFALAFVVQAAVGF   36
               SCOP domains ------------------------------------ SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh.....hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
                 Transcript ------------------------------------ Transcript
                3a0b k 5010 KLPEAYAIFDPLVDVLPVIPVLFFALAFVVQAAVGF 5045
                                  5019      5029      5039

Chain l from PDB  Type:PROTEIN  Length:37
 aligned with PSBL_THEVL | P12241 from UniProtKB/Swiss-Prot  Length:37

    Alignment length:37
                                    10        20        30       
          PSBL_THEVL      1 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN   37
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                3a0b l 5001 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN 5037
                                  5010      5020      5030

Chain m from PDB  Type:PROTEIN  Length:36
 aligned with PSBM_THEVL | P12312 from UniProtKB/Swiss-Prot  Length:36

    Alignment length:36
                                    10        20        30      
          PSBM_THEVL      1 MEVNQLGFIATALFVLVPSVFLIILYVQTESQQKSS   36
               SCOP domains ------------------------------------ SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhhh.hhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
                 Transcript ------------------------------------ Transcript
                3a0b m 5001 MEVNQLGFIATALFVLVPSVFLIILYVQTESQQKSS 5036
                                  5010      5020      5030

Chain n from PDB  Type:PROTEIN  Length:24
                                                         
               SCOP domains ------------------------ SCOP domains
               CATH domains ------------------------ CATH domains
               Pfam domains ------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhh..hhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------ SAPs(SNPs)
                    PROSITE ------------------------ PROSITE
                 Transcript ------------------------ Transcript
                3a0b n 5001 xxxxxxxxxxxxxxxxxxxxxxxx 5024
                            ||||||5010||||||5020||||
                            |||||5009-UNK|5018-UNK||
                         5001-UNK|5010-UNK|5019-UNK|
                          5002-UNK|5011-UNK|5020-UNK
                           5003-UNK|5012-UNK|5021-UNK
                            5004-UNK 5013-UNK 5022-UNK
                             5005-UNK 5014-UNK 5023-UNK
                              5006-UNK 5015-UNK 5024-UNK
                               5007-UNK 5016-UNK    
                                5008-UNK 5017-UNK

Chain o from PDB  Type:PROTEIN  Length:242
 aligned with PSBO_THEVL | D0VWR2 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:242
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241  
          PSBO_THEVL      2 TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP  243
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------3a0bo01 o:5050-5178,o:5215-5271 Photosystem II, cytochrome c-550 precursor                                                       3a0bo02 o:5179-5214                 3a0bo01 o:5050-5178,o:5215-5271                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh...........................eeeeeeeeeeeeeee...........eee.ee.......ee.....eee.....eee.........eeeee.....eeeee.........................eeee.................................hhhhhh.....eeeeeeeee........eeeeeeeeeee...........eeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0b o 5030 TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP 5271
                                  5039      5049      5059      5069      5079      5089      5099      5109      5119      5129      5139      5149      5159      5169      5179      5189      5199      5209      5219      5229      5239      5249      5259      5269

Chain t from PDB  Type:PROTEIN  Length:30
 aligned with PSBT_THEVL | P12313 from UniProtKB/Swiss-Prot  Length:32

    Alignment length:30
                                    10        20        30
          PSBT_THEVL      1 METITYVFIFACIIALFFFAIFFREPPRIT   30
               SCOP domains ------------------------------ SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains ------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                3a0b t 5001 METITYVFIFACIIALFFFAIFFREPPRIT 5030
                                  5010      5020      5030

Chain u from PDB  Type:PROTEIN  Length:98
 aligned with PSBU_THEVL | P56152 from UniProtKB/Swiss-Prot  Length:104

    Alignment length:98
                                    16        26        36        46        56        66        76        86        96        
          PSBU_THEVL      7 EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK  104
               SCOP domains -------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3a0bu01 u:5037-5123 Photosystem II 12 kDa extrinsic protein                            ----------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhh.......ee....hhhhhhhh.....hhhhhhhhh....hhhhhh.....hhhhhhhhhhh...ee....hhhhhh........... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                3a0b u 5037 EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK 5134
                                  5046      5056      5066      5076      5086      5096      5106      5116      5126

Chain v from PDB  Type:PROTEIN  Length:137
 aligned with CY550_THEVL | P0A387 from UniProtKB/Swiss-Prot  Length:163

    Alignment length:137
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       
         CY550_THEVL     27 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY  163
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3a0bv00 v:5027-5163 Cytochrome c                                                                                                          CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........ee......ee..hhhhhhhhhhhhhhhh.................hhhhhhhh.....hhhhhhhhhhh.................hhhhh.......hhhhhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------CYTC  PDB: v:5050-5149 UniProt: 50-149                                                              -------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3a0b v 5027 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY 5163
                                  5036      5046      5056      5066      5076      5086      5096      5106      5116      5126      5136      5146      5156

Chain x from PDB  Type:PROTEIN  Length:34
 aligned with PSBX_THEVL | D0VWR4 from UniProtKB/Swiss-Prot  Length:40

    Alignment length:34
                                    10        20        30    
          PSBX_THEVL      1 TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQID   34
               SCOP domains ---------------------------------- SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains ---------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------- PROSITE
                 Transcript ---------------------------------- Transcript
                3a0b x 5011 TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQID 5044
                                  5020      5030      5040

Chain y from PDB  Type:PROTEIN  Length:28
 aligned with YCF12_THEVL | D0VWR3 from UniProtKB/Swiss-Prot  Length:30

    Alignment length:28
                                    12        22        
         YCF12_THEVL      3 IAQLTMIAMIGIAGPMIIFLLAVRRGNL   30
               SCOP domains ---------------------------- SCOP domains
               CATH domains ---------------------------- CATH domains
               Pfam domains ---------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------- SAPs(SNPs)
                    PROSITE ---------------------------- PROSITE
                 Transcript ---------------------------- Transcript
                3a0b y 5001 IAQLTMIAMIGIAGPMIIFLLAVRRGNL 5028
                                  5010      5020

Chain z from PDB  Type:PROTEIN  Length:62
 aligned with PSBZ_THEVL | D0VWR5 from UniProtKB/Swiss-Prot  Length:62

    Alignment length:62
                                    10        20        30        40        50        60  
          PSBZ_THEVL      1 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV   62
               SCOP domains -------------------------------------------------------------- SCOP domains
               CATH domains 3a0bz00 z:5001-5062 Helix hairpin bin                          CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                3a0b z 5001 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV 5062
                                  5010      5020      5030      5040      5050      5060

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (8, 16)

Pfam Domains (0, 0)

Gene Ontology (30, 190)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,a (PSBA_THEVL | P51765)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0010242	oxygen evolving activity	Catalysis of the reaction: 2 H2O = O2 + 4 H+ + 4 e-. The evolution of oxygen from oxidizing water is carried out by the oxygen evolving complex in photosystem II of plants. P680+, the photochemically oxidized reaction-center chlorophyll of PSII, is a strong biological oxidant. The reduction potential of P680+ is more positive than that of water, and thus it can oxidize water to give O2 and H+ ions. The oxygen escapes as a gas while the H+ ions remain in solution inside the thylakoid vesicle.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009772	photosynthetic electron transport in photosystem II	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
	GO:0009635	response to herbicide	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a herbicide stimulus. Herbicides are chemicals used to kill or control the growth of plants.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain B,b (PSBB_THEVL | D0VWR1)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009767	photosynthetic electron transport chain	A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
	GO:0009772	photosynthetic electron transport in photosystem II	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009521	photosystem	A complex located in a photosynthetic membrane that consists of a photoreaction center associated with accessory pigments and electron carriers. Examples of this component are found in Arabidopsis thaliana and in photosynthetic bacterial and archaeal species.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain C,c (PSBC_THEVL | D0VWR7)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009767	photosynthetic electron transport chain	A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
	GO:0009772	photosynthetic electron transport in photosystem II	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009521	photosystem	A complex located in a photosynthetic membrane that consists of a photoreaction center associated with accessory pigments and electron carriers. Examples of this component are found in Arabidopsis thaliana and in photosynthetic bacterial and archaeal species.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain D,d (PSBD_THEVL | D0VWR8)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009772	photosynthetic electron transport in photosystem II	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain E,e (PSBE_THEVL | P12238)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009767	photosynthetic electron transport chain	A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain F,f (PSBF_THEVL | P12239)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009767	photosynthetic electron transport chain	A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain H,h (PSBH_THEVL | P19052)

molecular function
	GO:0042301	phosphate ion binding	Interacting selectively and non-covalently with phosphate.
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0050821	protein stabilization	Any process involved in maintaining the structure and integrity of a protein and preventing it from degradation or aggregation.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain I,i (PSBI_THEVL | P12240)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain J,j (PSBJ_THEVL | Q7DGD4)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain K,k (PSBK_THEVL | P19054)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain L,l (PSBL_THEVL | P12241)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain M,m (PSBM_THEVL | P12312)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain O,o (PSBO_THEVL | D0VWR2)

molecular function
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0042549	photosystem II stabilization	The stabilization of the photosystem II protein complex, resulting from the phosphorylation of its structural protein subunits, in a cell actively involved in photosynthesis.
cellular component
	GO:0019898	extrinsic component of membrane	The component of a membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009654	photosystem II oxygen evolving complex	A complex, composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins, that catalyzes the splitting of water to O2 and 4 H+. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ).
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain T,t (PSBT_THEVL | P12313)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain U,u (PSBU_THEVL | P56152)

biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0042549	photosystem II stabilization	The stabilization of the photosystem II protein complex, resulting from the phosphorylation of its structural protein subunits, in a cell actively involved in photosynthesis.
cellular component
	GO:0019898	extrinsic component of membrane	The component of a membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009654	photosystem II oxygen evolving complex	A complex, composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins, that catalyzes the splitting of water to O2 and 4 H+. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ).
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain V,v (CY550_THEVL | P0A387)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0018063	cytochrome c-heme linkage	The linkage of cytochromes and other heme proteins to heme.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0022904	respiratory electron transport chain	A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain X,x (PSBX_THEVL | D0VWR4)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain Y,y (YCF12_THEVL | D0VWR3)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain Z,z (PSBZ_THEVL | D0VWR5)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0042549	photosystem II stabilization	The stabilization of the photosystem II protein complex, resulting from the phosphorylation of its structural protein subunits, in a cell actively involved in photosynthesis.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (12, 178)

Sites (130, 130)

SS Bonds (2, 2)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 10)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (8, 16)

Pfam Domains (0, 0)

Gene Ontology (30, 190)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File