|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 1)
|
Asymmetric Unit (1, 1)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 3U2M) |
Asymmetric Unit (2, 2)
|
Asymmetric Unit (1, 1) Biological Unit 1 (1, 2) |
(no "Exon" information available for 3U2M) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:115 aligned with ALR_HUMAN | P55789 from UniProtKB/Swiss-Prot Length:205 Alignment length:115 100 110 120 130 140 150 160 170 180 190 200 ALR_HUMAN 91 FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD 205 SCOP domains d3u2ma_ A: Augmenter of liver regeneration SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------L---------------------------H----------- SAPs(SNPs) PROSITE ----ERV_ALR PDB: A:95-195 UniProt: 95-195 ---------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------- Transcript 3u2m A 91 FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPSEESAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD 205 100 110 120 130 140 150 160 170 180 190 200
|
Asymmetric Unit |
(no "CATH Domain" information available for 3U2M) |
(no "Pfam Domain" information available for 3U2M) |
Asymmetric Unit(hide GO term definitions) Chain A (ALR_HUMAN | P55789)
|
|
|
|
|
|
|