|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (3, 3)
Asymmetric Unit
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3O55) |
SAPs(SNPs)/Variants (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (1, 1)| Asymmetric Unit (1, 1) Biological Unit 1 (1, 2) |
Exons (0, 0)| (no "Exon" information available for 3O55) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:115 aligned with ALR_HUMAN | P55789 from UniProtKB/Swiss-Prot Length:205 Alignment length:115 100 110 120 130 140 150 160 170 180 190 200 ALR_HUMAN 91 FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD 205 SCOP domains d3o55a_ A: Augmenter of liver regeneration SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------Evr1_Alr-3o55A01 A:28-121 -------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------L---------------------------H----------- SAPs(SNPs) PROSITE ----ERV_ALR PDB: A:19-119 UniProt: 95-195 ---------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------- Transcript 3o55 A 15 FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD 129 24 34 44 54 64 74 84 94 104 114 124 Chain A from PDB Type:PROTEIN Length:115 aligned with Q9NY86_HUMAN | Q9NY86 from UniProtKB/TrEMBL Length:204 Alignment length:115 99 109 119 129 139 149 159 169 179 189 199 Q9NY86_HUMAN 90 FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD 204 SCOP domains d3o55a_ A: Augmenter of liver regeneration SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------Evr1_Alr-3o55A01 A:28-121 -------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------L---------------------------H----------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------- Transcript 3o55 A 15 FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD 129 24 34 44 54 64 74 84 94 104 114 124
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3O55) |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (11, 14)|
Asymmetric Unit(hide GO term definitions) Chain A (ALR_HUMAN | P55789)
Chain A (Q9NY86_HUMAN | Q9NY86)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|